KEGG   Vibrio tasmaniensis: VS_2193Help
Entry
VS_2193           CDS       T00812                                 

Definition
(GenBank) Probable aminotransferase yfbQ
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp00220  Arginine biosynthesis
vsp00250  Alanine, aspartate and glutamate metabolism
vsp00290  Valine, leucine and isoleucine biosynthesis
vsp01100  Metabolic pathways
vsp01110  Biosynthesis of secondary metabolites
vsp01130  Biosynthesis of antibiotics
vsp01210  2-Oxocarboxylic acid metabolism
vsp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vsp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VS_2193
   00290 Valine, leucine and isoleucine biosynthesis
    VS_2193
   00220 Arginine biosynthesis
    VS_2193
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vsp01007]
    VS_2193
Enzymes [BR:vsp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     VS_2193
    2.6.1.66  valine---pyruvate transaminase
     VS_2193
Amino acid related enzymes [BR:vsp01007]
 Aminotransferase (transaminase)
  Class I
   VS_2193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: CAV19359
UniProt: B7VHY9
LinkDB All DBs
Position
1:2343382..2344614
Genome map
AA seq 410 aa AA seqDB search
MQNIGMSSKLNSVCYEIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYSARKAVVQHYQKKGLRNLDVEDVYIGNGASELIVMSMQALLDNGD
EILVPAPDYPLWTASVALSGGTPVHYMCDEDADWYPDLDDMRAKISPKTRGIVLINPNNP
TGAVYSRDFLLQVVEIAREHGLIIFADEIYDKVLYDGAVHTSVATLAEDVLMVTFNGLSK
AYRVCGFRGGWMFLTGPKHIAKGYVEGLEMLASMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLLEQRDRAWELINKIPGVSCVKPKGAMYLFPKIDTKMYNIKDDQKFVLDFLKQEK
VLLVQGTGFNWPKPDHFRIVTLPHIEDLEIAIGRLERFLQTYSQDDLIEG
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatcgggatgtcgtcaaaactcaacagcgtatgctacgaaatcagggggcct
gtactcaaacatgctaagcgcatggaagaagaagggcataaaatactgaagcttaatatt
ggtaaccccgccccatttggttttgacgcccctgatgaaatccttgttgatgtaatccgt
aacctaccgacatctcaaggttactgcgactcaaaaggcatctattcagcccgcaaagcg
gttgttcagcactaccagaaaaaaggcctacgtaaccttgatgtagaagacgtttacatt
ggtaacggcgcatcagagcttatcgttatgtctatgcaggcgctactggataatggtgat
gaaatcttagttcccgctccagactacccactatggacagcgtctgttgcgctttctggt
ggtacacctgttcattacatgtgtgatgaagatgccgattggtacccagaccttgatgac
atgcgtgcgaagatctcaccaaagactcgcggcatcgttcttatcaacccgaacaaccca
acaggcgctgtatacagccgtgatttcctattacaagttgttgaaattgctcgtgagcac
gggttaattatcttcgctgatgaaatctacgacaaagtgctttacgacggtgcggtacac
acttcagttgcaacgcttgccgaagatgtattaatggtcacattcaacggtctgtctaag
gcttaccgtgtatgtggtttccgtggtggctggatgttcttaacgggtccaaaacacata
gcgaaaggctacgttgaagggctagaaatgctggcctcgatgcgtttgtgtgccaacgtg
ccaatgcaacacgctatccaaactgcactcggtggttatcagagtatcaatgagctgatt
cttcctggtggtcgactgcttgaacagcgcgaccgtgcatgggaactgatcaacaagatc
cctggcgtttcttgtgtgaaaccgaaaggcgcaatgtacctgttccctaaaatcgacacc
aagatgtacaacatcaaagacgatcagaagtttgtactcgacttccttaagcaagagaag
gtgttattggttcaaggtactggcttcaactggccgaaaccggatcacttccgcatcgtg
actctgccgcacatcgaagatctagaaatcgcgattggtcgtctagagcgcttcttacag
acctacagtcaagacgacctcatcgaaggttaa

DBGET integrated database retrieval system