KEGG   Vibrio tasmaniensis: VS_2495Help
Entry
VS_2495           CDS       T00812                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:vsp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VS_2495
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:vsp01002]
    VS_2495
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vsp01011]
    VS_2495
Enzymes [BR:vsp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     VS_2495
   3.4.21  Serine endopeptidases
    3.4.21.-  
     VS_2495
Peptidases [BR:vsp01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   VS_2495
Peptidoglycan biosynthesis and degradation proteins [BR:vsp01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   VS_2495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: CAV19652
UniProt: B7VJI8
LinkDB All DBs
Position
1:2666997..2668430
Genome map
AA seq 477 aa AA seqDB search
MRLLSSLLLCGLSLCSYSISAFEYLPLDKLPDGSSTSLILKSLSDDSSELNTNSDGFYPP
ASTLKLVTALAAKLELGDNFNYTTSIARSNKDVVIAFSGDPTLQREHLKNLLDQYAKSQS
KTIKGNLYLDNSAFTGYQRAVGWPWDILGVCYSAPSSAMTLDSNCAQASIYTKDNGTTRV
YIPAHYPIDVTTTATTVTRSGQKATQCDLELITTPDNTYKLSGCLVERKKPLPLKFAIQS
PELYTVQVVTSILKELRIEVKGNVVVGKKAKSGKSTLIASHSSEKLPELINIMLKKSDNL
IADNLTKTLGATFYVQPGSFNNGTEAIKQILLTKANIDLSQAQLVDGSGLSRNNRMTSQT
MAQVLRYIWENDKQLNLIEAMPTSGTDGTLKYRQSMRKAPIQGNIIAKSGSLYGSYNMAG
FGLDKAGKPNSLFVQFVRDYFPDTPDPEKPVEAPITQFERAFYTDVVEFSQTQSKPK
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcgccttctatccagcttactcctatgtggtttgtcactgtgtagctattcaattagt
gctttcgaatacctccctctagataaactgcccgatggcagtagcacaagcttgatactg
aagtcattgagtgatgattcgagtgagttgaacaccaatagcgatggcttttaccctccc
gccagtacgttaaagctagtcaccgctttggcagccaaattggagttaggagataatttt
aactacacgaccagcattgcgcgttctaataaagatgtcgtgatcgcattcagtggtgac
cctacactacaaagagagcatctaaaaaatcttttagatcaatatgctaaatcgcaatct
aaaacaatcaagggcaacttatacctcgataactcagcttttactggctatcaacgagcg
gttggttggccttgggacattttaggcgtttgttacagcgctccctctagtgcaatgacc
ttagacagtaactgcgcacaagcctctatttatacaaaagataacggtacaacacgcgta
tatatcccagctcattacccaatagacgtgacaactactgccaccacggtaactcgctct
ggacagaaggcaacacaatgcgacttggagctcataacgacaccagacaacacttacaag
ctctctggctgtttagttgaacgtaaaaaaccgttgccactcaagttcgcgattcaaagt
ccagaactttacaccgttcaagtcgttacatcgattcttaaagaactgagaattgaagta
aaaggcaatgtggtcgttggtaaaaaagctaaatcaggcaaaagcacgttaattgcaagt
cacagctcagagaaacttcccgaactgattaatatcatgctcaagaaatcagacaatcta
atagcagacaatctaaccaaaacactgggtgcgacattttatgttcaaccaggcagcttt
aataacggcactgaagcgataaagcagatattactgaccaaagccaatattgacctaagc
caagcgcagttggtcgatggttcagggctatctagaaataaccgcatgacctcgcaaacc
atggctcaggtgcttcgttatatctgggagaacgataaacagctcaacctgattgaggct
atgcctacatctggcactgatggaacgctcaaataccgtcaaagcatgcgaaaagcacca
atccaaggcaacattattgccaaaagtggttctttgtatgggagctacaacatggcaggc
tttggtttagataaagcgggaaaaccaaactctctatttgtacagtttgtccgtgattac
tttcctgacacaccagatccagaaaaaccagtagaagcacccatcacccagtttgaacga
gctttctacacagatgtagttgaattcagtcaaacacagagcaaacctaagtaa

DBGET integrated database retrieval system