KEGG   Vibrio tasmaniensis: VS_2972Help
Entry
VS_2972           CDS       T00812                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
vsp  Vibrio tasmaniensis
Brite
KEGG Orthology (KO) [BR:vsp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:vsp03012]
    VS_2972
   03029 Mitochondrial biogenesis [BR:vsp03029]
    VS_2972
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vsp04147]
    VS_2972
Translation factors [BR:vsp03012]
 Eukaryotic Type
  Elongation factors
   VS_2972
 Prokaryotic Type
   VS_2972
Mitochondrial biogenesis [BR:vsp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    VS_2972
Exosome [BR:vsp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   VS_2972
  Exosomal proteins of breast cancer cells
   VS_2972
  Exosomal proteins of colorectal cancer cells
   VS_2972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: CAV20267
UniProt: B7VM77
LinkDB All DBs
Position
1:complement(3132912..3134150)
Genome map
AA seq 412 aa AA seqDB search
MVAWSYFKPPNPYLEGHPMSKEKFERTKPHVNVGTIGHVDHGKTTLTAAICTTLAKVYGG
VAKDFASIDNAPEERERGITIATSHVEYDTPERHYAHVDCPGHADYVKNMITGAAQMDGG
ILVVAATDGPMPQTREHILLGRQVGIPYIIVFMNKCDMVDDEELLELVEMEVRELLSEYE
YPGDDLPVIQGSALGALNGEKQWEDKIVELAEALDSYIPLPERAVDLPFLLPIEDVFSIQ
GRGTVVTGRIERGILRVGDEVEIVGIKETTLTTCTGVEMFRKLLDEGRAGENVGALLRGT
KRDDVERGQVLSAKGSINPHTKFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGDI
TLPEGVEMVMPGDNVQMTVELIAPIAMDEGLRFAIREGGRTVGAGVVAKIFA
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
ttggttgcgtggtcttattttaagccacctaatccgtacctagagggacaccccatgtct
aaagaaaaatttgaacgtacgaaaccgcacgtaaacgttggtactatcggccacgttgac
cacggtaaaacaactctaactgctgctatctgtactacacttgcaaaagtgtacggcggt
gttgctaaagatttcgcatctatcgataacgctccagaagagcgcgagcgcggtatcaca
atcgcaacttctcacgttgagtacgatactcctgaacgtcactacgcacacgtagactgt
cctggacacgccgattatgttaaaaacatgatcactggtgctgctcaaatggacggcggt
atcctagttgttgctgctacagatggccctatgccacaaactcgtgagcacatcctactt
ggtcgtcaagttggtatcccttacatcatcgtattcatgaacaaatgtgacatggttgat
gacgaagagctacttgagctagtagaaatggaagttcgtgaacttctttctgagtacgag
tacccaggagacgacctaccagtaattcaaggttctgcacttggcgctctaaacggcgaa
aagcagtgggaagacaagatcgttgagcttgcagaagcactagattcttacattccactt
ccagagcgtgcagttgatctaccgttcctacttcctattgaagatgtattctcaatccaa
ggtcgtggtactgtagttactggtcgtatcgagcgcggtatcctacgtgtaggtgacgaa
gtagaaatcgttggtatcaaagagactactcttactacttgtactggtgttgaaatgttc
cgtaaactgcttgacgaaggtcgtgcaggtgagaacgttggtgcacttctacgtggtact
aagcgtgatgacgttgaacgtggccaagtactttctgctaaaggttcaatcaacccacac
actaagtttgagtctgaagtatacgtactttctaaagacgaaggcggccgtcacactcct
ttcttcaagggttaccgtccacagttctacttccgtacaactgacgtaacaggcgatatc
actctacctgaaggcgtagaaatggtaatgccaggtgacaacgttcaaatgactgttgag
ctaatcgctccaatcgcaatggacgaaggtctacgtttcgcaatccgcgaaggtggccgt
acagttggtgctggtgttgtagctaaaatctttgcataa

DBGET integrated database retrieval system