KEGG   Vibrio tasmaniensis: VS_II0113Help
Entry
VS_II0113         CDS       T00812                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp00564  Glycerophospholipid metabolism
vsp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vsp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    VS_II0113
Enzymes [BR:vsp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     VS_II0113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C DUF4657 NAD_binding_8 3HCDH_N Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: CAV25375
UniProt: B7VQ83
LinkDB All DBs
Position
2:complement(123588..125222)
Genome map
AA seq 544 aa AA seqDB search
MTANESSYRIQLCSKMLVRSEEVKTMSAQQNNSNNSTSSTLDLIVIGGGINGAGIAADAS
GRGLNVGLYEANDFASATSSASSKLIHGGLRYLEHYEFRLVSEALAEREVLLRKAPHVAQ
PMRFRLPHRPFLRPAWMIRCGLFLYDNLGKRTTLPGSKTVNLAKSGLLKPEMKTGFEYSD
CWVDDARMVLLNVLAAKENNAEVRNYCRVEKAHREGGVWHVTILDVMTNQRFERKAKALV
NAAGPWVKQFFDDGLEQASPRNIRLIKGSHIVVPRIHDEPKAYILQNKDNRIVFMIPYLD
KFSIIGTTDLEYKGDPRNVAIDDVEVDYLIDIVNQHFVKQLGREDVVWTYSGVRPLCDDE
SDSPQAITRDYTLELDAELDQAPLLSIFGGKLTTYRKLGEAALKKLEPHLTNMGAPWTAN
DTLPGGNFSCSREQLAKMIHTKYPWASEALLLRYVTQFGTYTWKLLEGADSEADLGIQFS
SEAHGVYQVEIDYLINEEMAMTDEDILWRRTKLGLYMIESEQQAVTDYLKEKLQSKVVSF
SQVG
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaaacgaaagttcatataggattcaattatgttctaaaatgctcgttcgctca
gaagaggtcaaaaccatgagtgctcaacaaaataattcaaacaacagtacatcttccact
ttagacttgatcgtgattggcggcggcatcaatggtgcaggcatcgcggcagatgcatca
ggtcgtggtctaaacgttggcttatacgaagcaaatgatttcgcgtctgcgacgtcttct
gctagctcaaagcttatccacggaggcctacgctaccttgaacattacgaatttcgtttg
gtttcggaagcactcgctgaacgtgaagtcttgttaagaaaagcacctcatgttgctcaa
ccaatgcgcttccgtctacctcatcgaccatttttacgcccagcttggatgattcgctgt
ggcctattcctttacgataacttgggtaagcgcaccactcttccgggaagtaagaccgtc
aacctagcgaaatcaggcctactgaaaccagaaatgaagacgggattcgaatactcagat
tgctgggttgatgatgcgcgtatggtattgcttaacgtgttagcagcaaaagagaacaac
gcagaagtacgtaactactgccgtgttgaaaaagcgcaccgtgaaggtggtgtttggcat
gtaacgatccttgatgtgatgacaaaccaacgctttgaacgcaaagcaaaggcgcttgtt
aacgctgctggtccttgggttaaacagttctttgatgatggattagagcaggcttcgcct
cgtaacattcgtcttataaaaggctcacacattgttgtgccacgcattcatgacgagcca
aaagcgtacattctgcaaaacaaagacaatcgcattgtgttcatgatcccttacctagat
aaattctcgatcatcggtactaccgaccttgaatacaaaggcgacccacgtaacgtcgca
attgatgatgtcgaagtggattacttgattgatatcgttaaccaacactttgttaaacag
ctcggtcgtgaagacgtggtttggacatacagtggcgtaagaccgctttgtgacgacgaa
tcggattcaccacaagcgatcactcgtgactacacgttggaattggacgcagagctagat
caagcaccactgctttcgatcttcggtggcaaactaaccacttaccgtaaactcggcgaa
gcagcacttaagaagcttgagccacacctaaccaacatgggagcaccttggacagctaac
gacacgcttccaggtggtaactttagttgcagcagagagcagcttgcgaagatgatccac
actaaatatccttgggcatctgaagcgctattacttcgctacgtgactcagttcggtact
tacacgtggaagctactggaaggcgcagatagcgaagctgaccttggcatccagttctca
agcgaagcgcatggcgtttatcaagtggaaatcgattacttgatcaatgaagagatggcg
atgacagacgaagacatcttgtggcgcagaaccaagcttggcctgtacatgatcgaatcc
gagcagcaagcggtgacggattacctgaaagagaagctacaaagcaaggtagtgagcttt
tctcaagtaggctaa

DBGET integrated database retrieval system