KEGG   Vibrio tasmaniensis: VS_II0163
Entry
VS_II0163         CDS       T00812                                 

Definition
(GenBank) Glycosidase
  KO
K01182  oligo-1,6-glucosidase [EC:3.2.1.10]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp00052  Galactose metabolism
vsp00500  Starch and sucrose metabolism
vsp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vsp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    VS_II0163
   00500 Starch and sucrose metabolism
    VS_II0163
Enzymes [BR:vsp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.10  oligo-1,6-glucosidase
     VS_II0163
SSDB
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase Alpha-amylase_C DUF3459 Slu7 Cyc-maltodext_C
Other DBs
NCBI-ProteinID: CAV25468
UniProt: B7VQD3
LinkDB
Position
2:complement(178073..179716)
AA seq 547 aa
MDIEMEQKWWHDAVVYQIYPRSFLDSNNDGIGDLNGIISKLDYLKELGINVIWLSPVYQS
PMDDNGYDISDYQAIAEEFGTMEEMKRLMDEAKERDIKIVMDLVVNHTSDEHRWFEQARS
SKDNPYRNYYIWRDAKPDGSAPDDQGSIFGGSAWQWDELTQQYYFHLFSKRQPDLNWENP
KVQEEVHTMMNWWIDLGIGGFRLDVIDLIGKEIDKGITGNGPRLHKLLQQMNQATFGNKD
LLTVGETWGATPEIAKLYSGQGRNELSMVFQFEHITLTWENGDKWNPIPLDLREFKNVLT
KWQLELADGGWNSLFWNNHDLPRLVSKYGDDKHFRVESAKMLATCLHFLKGTPYIYQGEE
IGMTNVAFDNLDQYKDIETHNFYKVKTESGVTHEHMMDAIHENSRDNARTPMHWNKQPNA
GFSDGTPWIELNPNYPEINVESALADPSSIFYHYKTLIELRKAHPAIVYGSFIPVFEEHD
KVFAYVRELDGEKLFVVCNFSNDNLTLDIPEQYQTQTLDCLINNYQTVTELSAKLELAPY
ESFAVKL
NT seq 1644 nt   +upstreamnt  +downstreamnt
gtggacattgagatggaacagaaatggtggcatgacgcagtggtctaccaaatttacccg
cgtagctttttagactcgaataatgacggtatcggtgacctaaatggaatcatcagcaaa
ctcgattacctcaaagaactaggcattaatgtcatttggctctctcctgtttatcaatct
ccaatggacgataacggctacgacatctccgactaccaagcgattgctgaagagtttggc
acgatggaagagatgaaacgcctgatggatgaagcgaaagaacgtgacattaagattgtt
atggatctagtggtaaatcatacgtcagatgagcaccgttggttcgagcaagcacgctct
tcaaaagacaatccgtatcgaaattattacatttggcgcgatgcaaaaccggatggcagt
gcaccggatgaccaaggttctatctttggcggaagtgcttggcagtgggatgaactcaca
caacaatattacttccatctattctcgaaacgtcagccagatttgaactgggaaaacccg
aaggttcaagaagaagttcatactatgatgaactggtggattgaccttggcatcggcggc
ttccgcttagatgtgattgatcttattggtaaagagatcgataaaggaatcactggaaac
ggaccaaggctgcacaagctattacaacaaatgaatcaggcgacctttggtaacaaggat
ttgttaaccgtaggagaaacttggggcgcaacaccagaaatagccaagctatacagcgga
caaggtagaaatgaactttctatggtattccaatttgagcacattaccctgacatgggaa
aacggtgacaaatggaaccctattccgcttgatcttcgagagttcaaaaatgtgctgacc
aagtggcagctagagctggccgatggtggttggaattcccttttttggaacaaccacgat
ttaccacgtttggtttcaaaatacggtgatgacaaacacttccgagttgagtcagcaaaa
atgctggcgacatgtttgcacttcttaaaaggcacaccttacatttatcaaggtgaagag
attggcatgaccaatgtcgcttttgacaatctagaccaatataaagatattgaaacgcac
aatttctataaagtaaaaacggaatcaggtgttactcatgaacacatgatggacgccatt
cacgagaacagccgtgacaacgctagaacacccatgcattggaacaagcaacctaatgca
ggtttctctgacggaacaccttggattgagctgaatccaaactacccagagatcaacgtc
gaaagtgcgttggctgatccaagttccatattttatcactacaagacattgatagagtta
cgaaaagctcacccagcgattgtctacggttcattcattcctgtttttgaagaacacgac
aaggttttcgcctacgtccgtgagttggatggtgaaaagctgtttgtagtttgtaacttc
tcaaacgacaacctgacactggatatacctgaacaataccaaactcagacgcttgattgt
ctgatcaataactatcaaacggtcactgagttgtcagccaagcttgaactggcaccgtat
gaatcatttgctgtaaaactgtaa

DBGET integrated database retrieval system