KEGG   Vibrio tasmaniensis: VS_II0746Help
Entry
VS_II0746         CDS       T00812                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vsp  Vibrio tasmaniensis
Pathway
vsp00473  D-Alanine metabolism
vsp00550  Peptidoglycan biosynthesis
vsp01100  Metabolic pathways
vsp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vsp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VS_II0746
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VS_II0746
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    VS_II0746
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vsp01011]
    VS_II0746
Enzymes [BR:vsp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     VS_II0746
Peptidoglycan biosynthesis and degradation proteins [BR:vsp01011]
 Precursor biosynthesis
  Amino acid ligase
   VS_II0746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 RimK ATPgrasp_ST SfsA
Motif
Other DBs
NCBI-ProteinID: CAV26458
UniProt: B7VRZ7
LinkDB All DBs
Position
2:complement(810377..811372)
Genome map
AA seq 331 aa AA seqDB search
MNTTNILLLCGGGSSEHEVSIVSANYLFEQLNSVTDFNVVRVEIKNEGWCLDSGELVYLD
INDQTLRGDNLESKVDFIVPCIHGFPGETGDIQSLFEMAKIPYLGCGSEASNNSFNKITS
KLWYDALGIPNTPYLFLSDNTEQAHAQATQAFESWGKVFVKAARQGSSVGCYQVNQVEEL
SEAINKAFTFSDQVLIEKSVVPRELEVAAYEIDGELQISKPGEVIAPNGAFYSYEEKYSA
DSHSITEVEATNLTDEQRELIADSARKVFTQMKLRHLSRIDFFLTQDNEIYLNEVNTFPG
MTPISMFPKMVEHDGHKFSQFLENCVRTSIS
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccacaaacatccttctactttgcggcggtggatcttcagagcatgaagtgtca
atcgtttcagccaattacctttttgaacaacttaatagcgttacagattttaacgttgtg
agagttgaaattaaaaacgaaggctggtgtcttgattcgggtgagttggtttatcttgat
attaacgatcaaaccttacgtggcgacaacttagaatctaaagtcgatttcattgttcca
tgtattcatggtttccctggcgaaacaggtgatattcaatcactgtttgaaatggctaag
attccgtacctaggttgtggttctgaagcaagcaacaacagcttcaataaaatcacatca
aaactttggtacgacgctctgggtatcccaaatacgccttatctgttcttatccgacaac
actgaacaagctcatgcacaggcgacacaagcctttgaaagttgggggaaagtgttcgtc
aaagcggctcgtcagggatcttccgttggctgttaccaagtcaatcaagtagaagaatta
agtgaagcaatcaacaaagcatttaccttctctgatcaagtgcttattgagaaatccgtg
gtgccaagagaactagaagttgccgcttatgaaatcgatggcgagctacagataagcaag
ccaggcgaggtgattgcacctaatggcgcattttactcttacgaagagaagtacagtgca
gacagccactcaattactgaagttgaagcaactaacttaaccgatgaacagcgtgaattg
attgcagatagcgcccgcaaggtattcacgcagatgaagcttcgtcacttgtctcgtatc
gatttcttcttaacacaagacaatgagatctacctgaacgaagtgaataccttcccaggt
atgacgccaatttccatgttcccaaaaatggttgaacatgacggccacaaattcagccag
ttcttagagaactgcgtgagaacaagcatttcttag

DBGET integrated database retrieval system