KEGG   Vibrio tapetis: A1244Help
Entry
A1244             CDS       T05424                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase, Fe
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vta  Vibrio tapetis
Brite
Enzymes [BR:vta01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A1244 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: SON49223
UniProt: A0A2N8ZBG2
LinkDB All DBs
Position
A:1317878..1318462
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKDALLPHISAETLDFHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTS
TGGVFNNAAQIWNHTFYWHCLAPKAGGEPTGAVADAINAAFGSFEEFKAKFTDSAINNFG
SSWTWLVKNADGSLEIVNTSNAATPLTDEGVTPLLTVDLWEHAYYIDYRNVRPDYMNGFW
ALVNWEFVAANLAK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcattcgaactaccagcacttccttacgcaaaagatgcactactaccacacatctca
gctgaaactttagactttcaccacggcaaacaccacaacacttacgttgttaagctaaat
ggtctaattcctggtactgagtttgaaggcaaaacactagaagagatcatcaaaacttct
actggcggtgtattcaataacgcagctcaaatttggaaccacacgttctactggcactgc
ctagctccaaaagcaggcggcgaaccaactggcgctgttgcggatgctatcaacgctgca
tttggttctttcgaagaatttaaagcaaaattcactgattcagcaatcaacaacttcggt
tcttcatggacttggcttgttaagaacgctgacggttctctagagattgttaacacgtct
aacgctgctactccactaacagacgaaggtgttacaccgcttctaactgtggatctttgg
gaacatgcttactacatcgattaccgtaacgttcgtccagattacatgaatggcttctgg
gctctagttaactgggaattcgtagctgcgaacctagctaaataa

DBGET integrated database retrieval system