KEGG   Vibrio tapetis: A2181Help
Entry
A2181             CDS       T05424                                 

Gene name
yfcX
Definition
(GenBank) fused enoyl-CoA hydratase and epimerase and isomerase; 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
vta  Vibrio tapetis
Pathway
vta00071  Fatty acid degradation
vta00280  Valine, leucine and isoleucine degradation
vta00281  Geraniol degradation
vta00310  Lysine degradation
vta00362  Benzoate degradation
vta00380  Tryptophan metabolism
vta00410  beta-Alanine metabolism
vta00640  Propanoate metabolism
vta00650  Butanoate metabolism
vta00903  Limonene and pinene degradation
vta00930  Caprolactam degradation
vta01100  Metabolic pathways
vta01110  Biosynthesis of secondary metabolites
vta01120  Microbial metabolism in diverse environments
vta01130  Biosynthesis of antibiotics
vta01200  Carbon metabolism
vta01212  Fatty acid metabolism
Module
vta_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A2181 (yfcX)
   00650 Butanoate metabolism
    A2181 (yfcX)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A2181 (yfcX)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A2181 (yfcX)
   00310 Lysine degradation
    A2181 (yfcX)
   00380 Tryptophan metabolism
    A2181 (yfcX)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A2181 (yfcX)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A2181 (yfcX)
   00281 Geraniol degradation
    A2181 (yfcX)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A2181 (yfcX)
   00930 Caprolactam degradation
    A2181 (yfcX)
Enzymes [BR:vta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     A2181 (yfcX)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     A2181 (yfcX)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     A2181 (yfcX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: SON50160
UniProt: A0A2N8ZE53
LinkDB All DBs
Position
A:complement(2304696..2306807)
Genome map
AA seq 703 aa AA seqDB search
MSNQNAFQLTIDDQGLAWLAIDVPGEKMNTLQAQFTEEMQTILMELEAKKHEVSGLIIHS
LKPDNFVAGADVRMLDACTTAEEAQGLAAQGQQMFNQLEALPFPVVSAIHGPCLGGGLEL
ALACDYRVCSDSDKTRLGLPEVQLGLLPGSGGTQRLPRLIGLLPSLDLILTGKQLRAKKA
NKLGVVDACVPESILLEVAKKYASGNKAKRKLATKERLLSGVKFGRNFVFDQASKKTLAK
TRGNYPAADAILDVIAYGLEHGIEKGLENEAKRFGVLCMSNESKALRSIFFATTEMKKEN
GTDEKPRLVSRVGVLGGGLMGAGISHVSVSKAKVPVRIKDVSNDGVLGAMNYNYKLLSKQ
KKRRILTKAELQYRMSQLSGGTDYTAFKNTDMVIEAVFEDLALKQGMVKEIEQYGNERTI
FATNTSSLPIHQIAAEAQRPENVIGLHYFSPVEKMPLVEVIPHEGTSDEVISTTVELARK
QGKTPIVVADKAGFYVNRILAPYMNESAQVLLGGEPIEQLDNALLNFGFPVGPIALLDEV
GVDIGAKIMPILVEELGARFKAPEVFDVLLNDGRKGRKVGKGFYSYNGKKKEVDKSVYKL
LKLQPEAKLPEKDIALRCVLPMLNEAVRCLDEGIIRSARDGDIGAIFGIGFPPFLGGPFR
YMDQIGTKELVNIMNNFAEKYGDRFAPCDGLLTRAGSDARFYD
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcaaaacgcatttcaattaaccattgatgaccaaggccttgcatggcttgct
attgatgtccctggcgaaaaaatgaatacccttcaagctcagtttactgaagagatgcaa
accatcttgatggaacttgaagctaaaaagcatgaagtatctggtttaatcattcattcc
ttgaaacctgacaactttgttgcgggggctgatgtacgcatgctcgacgcgtgtactaca
gcggaagaggcacaaggtttggccgcacaaggtcaacaaatgtttaaccagcttgaagca
ttgcctttccccgtggtttctgcaatccatggcccttgtttaggtggtggcttagagctt
gcactggcttgtgattaccgtgtatgcagcgactcagacaaaacgcgtttgggtttacct
gaagttcagctcggtttactgccaggttccggcggtacacaaaggctgcctcgcttaatt
ggtttactgccaagcttagacttaattttgactggtaagcagttgagagctaaaaaagca
aataagttgggtgtggttgatgcttgtgtacctgaatctattttactggaggtagccaag
aagtatgcctctggtaataaggcaaagcgtaaattggcgaccaaagaacgcctgctttct
ggtgtgaagtttggccgaaattttgtgtttgaccaagcgagcaagaagacacttgccaaa
actcgcggtaattatccagcggcggacgctatcttagacgttattgcttatggtttagaa
cacggtatcgaaaaaggtttagaaaacgaggctaaacgttttggtgtgttgtgcatgagt
aacgaatccaaagcattgcgttctattttctttgcgacaacggaaatgaaaaaagaaaac
ggcactgatgaaaagcctcggttagtttcgcgtgttggtgtacttggtggtggccttatg
ggggcgggcattagtcatgtgtctgtttctaaagccaaagtgccagtacgaatcaaagat
gtttctaacgatggtgtgttaggagcaatgaattacaattacaaactgcttagtaagcag
aaaaagcgccgtattttaactaaagcagaactgcaatatcgtatgtcccagttgtctggt
ggtacggattacaccgcctttaaaaatacagatatggtgattgaagcggtatttgaagat
cttgcattaaagcagggcatggtaaaagaaatagagcaatacggaaacgagcgcactatt
tttgctactaatacgtcttctttgcccattcatcaaattgcggccgaagcgcaacggccc
gaaaacgttataggtttgcactactttagcccggttgagaaaatgccgttggtggaagtc
attccacatgaagggacttctgatgaagttatctcaactacagtggaattggctcgtaag
caaggtaagacccccatcgttgtggcggataaagcgggcttctatgtcaaccgaatttta
gcgccttacatgaatgagtctgcgcaagtgttgttaggtggtgagcctatcgagcaactt
gataatgctttgcttaatttcggtttccctgtagggccaatagcgctgcttgatgaagtt
ggcgttgatattggcgcgaagataatgccaattttggtcgaagagttaggggcgcgattt
aaggctccggaagtgtttgatgttttgctgaatgatggccgtaaagggcgtaaagtaggc
aaaggtttttacagctataacggcaaaaagaaagaagtggataaaagcgtttataagcta
ttgaaacttcagccagaagcgaaactgccagaaaaagacatcgcgctacgttgtgtattg
ccaatgctgaacgaggcggtacgctgtttagatgaggggattatccgcagtgcaagagat
ggcgacatcggggctatttttggtattggtttcccaccattcttaggtggcccgttccgt
tacatggaccaaatcggcactaaagagttagtcaacatcatgaacaattttgccgagaaa
tacggcgataggttcgcaccttgcgatggcttattaacgagagcgggcagtgatgcacgt
ttctacgattaa

DBGET integrated database retrieval system