KEGG   Vibrio tapetis: B1500
Entry
B1500             CDS       T05424                                 

Gene name
dexB
Definition
(GenBank) Glucan 1,6-alpha-glucosidase
  KO
K01182  oligo-1,6-glucosidase [EC:3.2.1.10]
Organism
vta  Vibrio tapetis
Pathway
vta00052  Galactose metabolism
vta00500  Starch and sucrose metabolism
vta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    B1500 (dexB)
   00500 Starch and sucrose metabolism
    B1500 (dexB)
Enzymes [BR:vta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.10  oligo-1,6-glucosidase
     B1500 (dexB)
SSDB
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase Cyc-maltodext_C Alpha-amylase_C
Other DBs
NCBI-ProteinID: SON53111
UniProt: A0A2N8ZMF3
LinkDB
Position
B:1540059..1541693
AA seq 544 aa
MEQKWWHDAVVYQIYPRSFCDSNKDGIGDITGIISKLDYLQTLGVNVLWLSPVYQSPMDD
NGYDISDYQEIAQEFGSMEDMEALFYQAQQRDIKIVMDLVVNHTSDEHEWFKQARESKDS
PYRDFYIWRDAKPDGSVPDDQCSVFGGSAWEWCEKSQQYFYHIFSRCQPDLNWNNPEMVK
RIHDMMNWWIDKGIGGFRLDVIDLIGKNIDKRIMGNGPKLHQRLQDMNQATFGDKDLLTV
GETWDATPEIAKMYSEPNRNELSMVFQFEHITLTWQDGDKWRPKAKDINALKEVLIKWQL
ELKDGGWNSLFWNNHDLPRVVSKYGCVGEHRVASAKMLATAMHMMKGTPYIYQGEEIGMT
NVAFDSLEDYRDIETLNFYDVKTGSGTSHDEMMEAIYQNSRDNSRTPMQWNGSENAGFTQ
GSPWINVNPNHKDINVEQALEDNNSIFYHYQSLIALRKAHPAIVYGDFTPILRDNEQIFA
YLRHDDNERLLVINNFSNEEQAIVLSEQFQAQEVECLLSNRQPVTELSNKLYLTPYESMV
LKLK
NT seq 1635 nt   +upstreamnt  +downstreamnt
atggaacagaaatggtggcatgacgcggtagtctatcaaatttacccgcgaagcttttgt
gattcgaataaagacggtattggcgacattacgggcattatcagtaagctagactactta
cagacgctaggcgtgaatgttctttggttatctccggtttatcagtcgccaatggacgac
aacggatatgatatttcagattaccaagagatagcccaagagtttggttcaatggaagat
atggaagccttgttttatcaggctcaacagcgagacattaagatcgtgatggatcttgtt
gttaaccatacttccgatgagcacgaatggttcaaacaagctcgtgaatcgaaagactca
ccctaccgtgatttttatatttggcgagacgcaaagccagacggctcagtgccggatgac
cagtgttctgtttttggcggttcagcgtgggagtggtgtgaaaagtctcaacaatatttt
tatcatattttttcgcgctgccagcctgatttaaactggaataacccagagatggttaag
cgaatccacgacatgatgaattggtggattgacaagggcatcggtggttttcgtttggat
gtgattgacctgattggtaaaaacatagataagcgaatcatggggaatggccctaaactg
caccagcgattgcaagatatgaaccaagcaacgttcggagataaagacttattaaccgtc
ggtgaaacctgggatgcaacgccagaaattgccaaaatgtactcagagccgaaccgcaat
gaattgtcgatggtgtttcaatttgaacacattacattgacctggcaagacggagacaaa
tggcgaccaaaggccaaagatattaacgcactaaaagaagtgttaattaagtggcaattg
gagttaaaagacggtggttggaattcgctgttttggaataaccatgatttgccacgtgtt
gtctctaaatatggctgcgttggtgagcatagggttgcgtctgcaaaaatgttagcaaca
gcaatgcacatgatgaaaggtacgccgtacatttaccaaggtgaagagattggcatgacc
aatgtcgcgtttgattctcttgaggactaccgagatattgaaacgcttaacttttatgac
gtaaaaaccggttcgggcaccagtcatgatgaaatgatggaagcgatttatcagaatagt
cgagataattcgcgtacgcctatgcaatggaatgggagtgaaaacgctggctttactcaa
ggaagcccttggataaacgtcaaccctaaccacaaggacattaacgtcgagcaagcattg
gaagataacaactccattttttatcattaccagtctttaatcgcgttaagaaaagcgcac
ccggcgattgtttatggtgatttcacaccaatcttgcgagataacgagcagatatttgct
tatcttcgtcatgatgataacgaacgcttgttggtgatcaataactttagtaatgaagag
caggcgattgttttgtcagaacaatttcaggcccaagaagtagagtgcttattgtctaat
cggcagccagtgacagagcttagcaataagctgtacctgacgccgtatgaatcgatggtc
ttgaagctgaagtag

DBGET integrated database retrieval system