KEGG   Vagococcus teuberi: BHY08_00775
Entry
BHY08_00775       CDS       T04578                                 

Definition
(GenBank) ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
vte  Vagococcus teuberi
Pathway
vte00030  Pentose phosphate pathway
vte00040  Pentose and glucuronate interconversions
vte01100  Metabolic pathways
vte01110  Biosynthesis of secondary metabolites
vte01120  Microbial metabolism in diverse environments
vte01200  Carbon metabolism
vte01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BHY08_00775
   00040 Pentose and glucuronate interconversions
    BHY08_00775
Enzymes [BR:vte01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     BHY08_00775
SSDB
Motif
Pfam: Ribul_P_3_epim PcrB QRPTase_C Peripla_BP_4 YmdB
Other DBs
NCBI-ProteinID: APB30486
UniProt: A0A1J0A3I0
LinkDB
Position
162264..162917
AA seq 217 aa
MVKIAPSILSADFSKLGEDVKRVDKAGADYIHIDVMDGQFVPNITFGPALISSIRPMTDL
IFDVHLMIVDPERFIDEFVKAGSDIITVHAESTTHLHRVIQQIKASGVKAGVVINPGTPV
EVIKPVLSMVDLVLVMTVNPGFGGQKFILECLDKVSELAELRQANGYTYEIEVDGGVDDK
TAKECVKAGADVLVAGSYVYKYDDVAEPIKKLKEAGK
NT seq 654 nt   +upstreamnt  +downstreamnt
atggtaaagatagcaccatcaatattaagcgcagatttttcaaaattgggagaagatgtt
aaacgtgttgataaagctggagcagattatattcacattgatgtaatggatggacaattt
gttccaaatattacgttcggtccagcacttatttcatctattcgtcctatgactgattta
atttttgatgttcacttgatgatagtagatccggaacgttttattgatgagtttgtaaaa
gctggttctgatattattacagttcatgctgaaagtacgactcatttacaccgtgtcatt
caacaaattaaagcgagtggcgtaaaagctggagttgtcattaatccaggaacaccagtt
gaagtgattaaacctgttttatcaatggttgatttagtcttagtgatgacagttaatcca
ggatttggtggtcaaaaattcatcttagaatgtttagataaagtaagtgaactagcagag
ttacgacaagctaatggatacacttatgaaattgaagttgacggtggcgtggatgataag
actgcaaaagaatgtgtcaaagcaggagcagatgtgttagtggccggatcatatgtttat
aaatatgatgatgtcgctgagccgattaaaaaattaaaagaagcaggtaagtaa

DBGET integrated database retrieval system