KEGG   Vagococcus teuberi: BHY08_03170Help
Entry
BHY08_03170       CDS       T04578                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
vte  Vagococcus teuberi
Brite
KEGG Orthology (KO) [BR:vte00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BHY08_03170
Enzymes [BR:vte01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BHY08_03170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like FAD_binding_3 AlaDh_PNT_C Thi4 DAO Glutaredoxin K_oxygenase
Motif
Other DBs
NCBI-ProteinID: APB30919
UniProt: A0A1J0A4V2
LinkDB All DBs
Position
653464..654990
Genome map
AA seq 508 aa AA seqDB search
MLDNETKAQLKQYLELLESDIEFKASLDESDSSNKVREFLTGVCELSPRLTLVEETLKRT
PSFEINQPGQTSGVMFAGLPLGHEFSSFILALLQVSGRAPKVEDSVINVIKKIDEPMSFE
TFVSLTCHNCPDVVQALNIMSVVNPNISHTMIEGGMYQDEVNEKKVMAVPTVFLNGEEFS
SGRMELSTILEKILGSVDISDIDQENPYDVLVIGGGPAGGAAAIYAARKGIRTGMVVDTF
GGQVMDTLGIENVIGTPYIEGPQLMNQVEEHVNQYNVDIMKNQRAKDIQKNDFVEVSLES
GAVVKTKSLVISTGARWRNINVPGEKEFKNKGIAYCPHCDGPLFAGKDIAVIGGGNSGIE
AAIDLAGMGKHVYVLEFLPELKADKVLQDKLYSLPNVTVITNAATKSIEGSDSVEKLVYE
DVNTKEQHELNVSGVFILIGLVPNTEWLPDTIDTTDRGEILVDSHGMTNVPGVFAAGDCT
NSAYKQIIISMGSGATAALGAFDYLIRQ
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgttagataacgaaacaaaagctcaattaaagcagtatttagaattacttgaatccgac
atagagtttaaagcgagtttggatgagagtgactcttcaaataaagtaagagaattccta
acaggagtttgtgagttgtctccacgattaacactggttgaagaaacattaaaaagaaca
cctagttttgagattaatcaaccaggtcaaacaagtggtgtgatgtttgcaggactgcct
ttaggacatgaattttcatcatttattttagcgttattacaagtgagtggacgtgcacct
aaagttgaagactctgtaattaatgtgattaaaaaaattgatgagccgatgagttttgaa
acatttgttagtttaacatgccataattgcccggatgtggttcaagcactaaatatcatg
agtgttgttaatccaaacatttctcacacgatgattgaaggtggtatgtatcaagacgaa
gttaatgagaaaaaagtcatggcagtgcctaccgtttttctaaatggagaggaattttca
agtggtcgtatggaattgagtactattttagaaaaaattcttggtagtgttgatatcagt
gatatcgatcaagaaaatccatatgatgtgcttgtgattggtggaggacctgctggtgga
gctgccgcaatttatgcagcaagaaaaggaatccgtactggaatggtagttgatacattc
ggtggccaagtgatggatacattaggtattgaaaatgttattggcacaccttatatagaa
ggcccacagttgatgaatcaagtcgaagagcatgtgaaccaatacaatgttgatattatg
aaaaatcaacgagcaaaagatattcagaaaaatgattttgttgaagtgtctctagaaagc
ggagcagtggtaaaaacgaaatcattagttatttcaacgggtgccagatggcgaaacatc
aatgtacctggtgaaaaagaatttaaaaataaagggattgcctattgtcctcactgtgac
ggcccattatttgcaggcaaagatattgcagttattggtggaggaaattctggtattgag
gctgctattgatttagctggtatgggaaaacatgtttatgtactagaatttttacctgaa
ttaaaagccgataaagtgttgcaagataaattatattcactaccaaatgttactgtgata
acaaatgcagccactaaatcaattgagggtagtgatagtgttgaaaaattagtttatgaa
gatgttaatacgaaagaacaacatgaattaaatgtcagtggtgtgttcattttgattggg
ttagtccccaatacagaatggttgccagacaccattgacacaacagatcgtggtgaaatc
ttagttgatagccatggtatgactaatgttccaggcgtttttgctgcaggagattgtaca
aatagtgcgtacaaacaaattattatctctatgggaagtggcgcaacagctgctttagga
gcgtttgattatttaattcgtcaataa

DBGET integrated database retrieval system