KEGG   Vagococcus teuberi: BHY08_04960
Entry
BHY08_04960       CDS       T04578                                 

Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
vte  Vagococcus teuberi
Pathway
vte00471  D-Glutamine and D-glutamate metabolism
vte00550  Peptidoglycan biosynthesis
vte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vte00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BHY08_04960
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BHY08_04960
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vte01011]
    BHY08_04960
Enzymes [BR:vte01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     BHY08_04960
Peptidoglycan biosynthesis and degradation proteins [BR:vte01011]
 Precursor biosynthesis
  Amino acid ligase
   BHY08_04960
SSDB
Motif
Pfam: Mur_ligase Mur_ligase_M Mur_ligase_C
Other DBs
NCBI-ProteinID: APB31234
UniProt: A0A1J0A5P0
LinkDB
Position
1038126..1039463
AA seq 445 aa
MELQQNKIYHFVGIKGTGMSALALILHQKGYKVQGSDIAKYIFTQRELELANITIEPFQE
VNIQEDMVVIAGNAFPDSHVEIKAALKKGLPVIRYHKFLGEFIKHFTSIAVTGSHGKTTT
TGLLSHVFSGIEPTSYLIGDGTGHGEPNANFFCFEACEYRRHFLAYSPDYAIMTNIDFDH
PDYYHGIEDVFDAFQSFANQVKKGIIAFGDDKNLRRLKTKAPIYYYGLNDTDDFQAVNIK
RTTEGSSFDVLHKGSNIGSFKVPTYGVHNILNALSVIAISHLEGFDMTLVAQEMLTFGGV
KRRFSEKCVSDMIIVDDYAHHPAEIKVTIDAARQKYPDKEIIAVFQPHTFTRTIALLDEF
AESLDHADYVYLCDIFGSAREEVGSVKIEDLGVKISKGGDLITLENMSPLLDYQDAVVIF
MGAGDVQKFEVAYESLLGSTRPNTM
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggaactgcaacaaaacaaaatataccattttgtcggaattaaaggaacagggatgagt
gctttagctttaatcttgcatcaaaaaggttataaagtacaaggttctgatatagcaaaa
tatatttttactcagagagaacttgagttagcgaatattactatcgagccattccaagaa
gtaaatattcaagaagatatggttgttattgcaggaaatgcgtttcctgatagtcatgtc
gaaataaaagcagctctaaaaaaaggcttgccagtgattcgttaccacaaatttttaggt
gaatttattaaacattttacaagtattgctgtaacaggttcacatggaaaaacaaccaca
acaggtttactatctcatgtattctctggtattgaaccgacaagttacttaatcggagat
ggaactggacacggagaaccaaatgcaaattttttctgttttgaagcatgtgagtaccgt
cgccatttcttagcatactcaccagattacgccatcatgacaaatatcgattttgatcac
ccggattattatcatggcattgaagacgtatttgatgcgtttcaatcatttgctaatcaa
gtcaaaaaaggtattattgcgtttggagatgataaaaacttacgtcgtttgaaaactaag
gcaccaatttattattatggtttaaatgatacagatgatttccaagcagtgaatatcaaa
agaacaacagaaggatcttcttttgatgtgttacataaaggtagtaatatcggttcattc
aaagtccctacttatggtgttcataatattttaaatgcgttaagtgtcattgcaatttca
catcttgaaggattcgatatgacattagtggcacaagagatgttgacatttggtggcgtg
aaacgtcgttttagtgaaaaatgtgtgtctgacatgatcattgttgatgactatgcgcat
catccagctgaaatcaaagtgacgattgatgcagcaagacaaaaataccctgataaagaa
attattgcagtatttcaaccgcacacttttactaggaccattgcgttactagatgagttt
gctgaatctcttgatcatgcagactatgtttatttatgtgatatctttggatcagctaga
gaagaagttggctctgttaaaatagaagacttaggcgttaaaatttctaaaggtggcgat
ttaattacattagaaaatatgtcaccattgcttgactaccaagatgctgttgtcattttt
atgggagcaggagacgtacagaaatttgaagtggcgtatgaaagtttattaggaagtaca
cgtccaaacacaatgtag

DBGET integrated database retrieval system