KEGG   Vibrio tubiashii: IX91_02390Help
Entry
IX91_02390        CDS       T03445                                 

Definition
(GenBank) peptidase
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
vtu  Vibrio tubiashii
Pathway
vtu00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:vtu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    IX91_02390
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:vtu01003]
    IX91_02390
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vtu01011]
    IX91_02390
Enzymes [BR:vtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     IX91_02390
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     IX91_02390
Glycosyltransferases [BR:vtu01003]
 Polysaccharide
  Bacterial polysaccharide
   IX91_02390
Peptidoglycan biosynthesis and degradation proteins [BR:vtu01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   IX91_02390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AIW13061
UniProt: F9SZA3
LinkDB All DBs
Position
1:469280..471643
Genome map
AA seq 787 aa AA seqDB search
MTKKSTSAGTKKTTSKPVRKRATKSPKRSPNKKPQRSWLKAIWSLSWKLALAGIAVLLVV
GIYLDTLVKQRFEGQLFDLPTVVYARILNLAPGDSITIQEVRNELDVLNYRKVRQPRYPG
EYSSSSTKIELIRRPFEFSDGPEPDRRVMLHFSKNNLERIQSLETKGDLGYLRIEPKMLG
MLEKNHDEQRLFVKRVQFPEVMIDALLATEDRDFYHHDGVSPLAIARALIVNVKAGRTVQ
GGSTLTQQLAKNLFLSSDRTLWRKIREAYIALILDHRYSKDRILEAYLNEVYLGQSRGQA
IHGFGLAARLYFGQPIQELRIDQLALLVGMVKGPSYYNPIRFPERAKKRRDLVLRLMMQQ
GTLTANEYDMAASRPLDIQDNPQIASRQPAYFQQLKIELREKVGEAFQSDVGLKVFTSLD
PVSQHELEQAIAKKIPQLASVAGRSLEGAAVAVDRHSGEIRAMVGGKRTGYDGFNRALNA
SRQIGSLAKPAVYLTALEQPEKYNLATTLHDKPISLKGSKGNVWSPRNYDRKFRGDVPLY
IALAKSLNVPTVELGMQVGIPSVVKTLEKLGVDKSEIRPVPSMFLGSFTLTPFQVAQMYQ
TLTNSGKQARLSALRSVIDLDGNVLYQSLPRVSQTVDQQAAWLTTYAMKRGVLEGTGRYL
NSQFGWAALAGKTGTSNDTRDSWFVGVDGREVTTIWLGRDDNKPTKLTGSSGALRVYAEY
LKHRIPEKLTLPWPQGVSTLGFAKTAQGSLDLDCSNQFKLPVWDVGGSLKKQCENQPKQW
IKELFSW
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagaaatcaacgtcggcaggcactaaaaagacaaccagtaagcctgtgcgtaaa
cgcgcgactaaatccccaaaacggagcccgaacaagaagccacagcgttcttggttaaag
gctatctggagcttgagctggaagcttgctttagccggtatcgctgtgttgctggtggtc
ggcatctatcttgatacactggtgaaacagcgctttgaaggacagcttttcgacctaccg
acagtggtttacgcacgtattcttaacctagcgccaggggattcgattaccatccaagag
gtgcgcaatgagctggatgtacttaactatcgtaaggtgcgccaaccccgttatcccggt
gagtattcatcatcgtcaactaagatcgagctaatacgtcgtccgtttgagtttagtgac
ggtcctgagccagatcgtcgcgtgatgctccacttctcgaaaaataatcttgagcggatt
caatcgttagagaccaaaggtgatctcggttatctgcgtattgagcctaagatgttagga
atgcttgagaaaaaccatgatgagcaaaggctatttgttaaacgtgtgcaatttccagaa
gtgatgatcgatgccttactggctactgaggatcgtgatttttatcatcacgatggtgtg
tcaccattagcgatagctcgtgcactaatagtgaatgttaaggcagggcgaacggttcaa
gggggaagtacccttactcagcagttagcgaaaaacctatttttatcaagcgaccgaaca
ttgtggcgtaagatccgcgaagcttatatcgctctaattcttgatcaccgctacagcaaa
gatcggatcttagaggcgtatcttaatgaagtgtatctagggcaaagccgcggtcaggca
attcatggttttggcttagcggctcggctttatttcggtcagcctattcaagagttacgt
atcgatcagttggctttgttagttggtatggtgaaaggtccttcatactacaatccaatc
cgtttcccagagcgtgccaaaaagcgacgtgacttagtactaagattgatgatgcaacag
ggtacgctaactgcgaatgagtatgatatggccgccagtcgaccgttggatattcaagat
aatccacagatagccagtcgtcagcctgcgtacttccaacagttgaaaattgagctgaga
gagaaagtgggcgaagctttccagtcagatgttggcttgaaagtctttacctcactagac
cctgtttctcagcatgaactcgagcaggctatagcgaagaaaatcccgcaacttgctagc
gttgcgggtaggtctttagagggtgccgctgtcgccgttgatcgccatagcggagaaatt
cgcgctatggttggtggtaaacgcacgggctatgacggttttaaccgcgcgctaaatgcc
agtcgtcaaattggctctctggctaagccggcagtttacttaaccgcgcttgagcagccg
gagaaatacaacctcgcgacgactttgcatgataagccaatcagtttaaagggcagtaaa
ggtaacgtttggtcgccgcgtaattatgatcgtaaattccgtggtgatgttccgctatat
attgccttagccaagtcattaaatgtgccaactgttgaactagggatgcaagtaggcata
cctagcgtagttaaaaccttagaaaagttaggcgtggataaaagtgaaattcgccctgtg
ccgtcgatgttccttggctcattcacactgacgccattccaagtggcacagatgtatcaa
accctgaccaactcaggtaagcaggctaggttgtccgcgctccgttcagtcatcgattta
gacggtaatgttttgtatcagtcactgccaagagtgtcacaaaccgttgatcagcaagcg
gcatggctgaccacttatgcgatgaagcgtggggtacttgaagggacggggcgttacctt
aatagccaatttggctgggctgcactagcaggtaaaacaggcaccagtaacgatacccgt
gacagttggtttgtcggtgttgatgggcgcgaggtgactaccatatggttaggtcgagat
gacaacaaaccgactaagctgacaggctctagtggcgcattgagagtttacgctgagtat
ctaaagcatcgaattccagagaaattaaccctgccttggccgcaaggtgtcagcacttta
ggttttgcgaaaacagcgcagggtagtttagatcttgattgttctaatcagtttaaatta
ccggtgtgggatgttggcggcagtctgaaaaaacagtgcgagaatcaacccaaacaatgg
ataaaagaattatttagttggtag

DBGET integrated database retrieval system