KEGG   Vibrio tubiashii: IX91_03200Help
Entry
IX91_03200        CDS       T03445                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
vtu  Vibrio tubiashii
Brite
KEGG Orthology (KO) [BR:vtu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    IX91_03200
Enzymes [BR:vtu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     IX91_03200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like DAO FAD_oxidored Glutaredoxin FAD_binding_3 NAD_binding_8 Thioredoxin_9 AlaDh_PNT_C Thi4 Lycopene_cycl DUF1640 DUF4404 Thioredoxin_4 NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AIW13210
UniProt: F9TBM5
LinkDB All DBs
Position
1:660990..662582
Genome map
AA seq 530 aa AA seqDB search
MLDQAMKQQLKAYLENLKTDVQLVLSLDESETASKLQALADDIASLTDKIQVTRDDNASS
RKPIMQVVNQTQGTAIGFAGLPMGHEFTSLVLALLHSGGHPIKLEAEVIEQIKQLDQALN
VEIFISLSCQNCPEVVQAFNMMSAINPLINTTMIDGAAFQDEVKSRDIMAVPSVFINGEL
FGQGRMSLAEILNKVDSGAAAKKAASLNEQAPFDVLVVGGGPAGSSAAIYAARKGIRTGV
VAERFGGQAMDTMAIENFISVKATTGPKLVASLEEHVKEYGVEVMTEQRAANIIDAEQTE
DGYIHVELESGAVLKARTVITSTGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKKTA
VIGGGNSGIEAAIDLAGIVEHVTVLEFADTLRADQVLIDKANATPNIEIIKMAQTTQVLG
DGNRVTGLEYQDRNTGEIKKIELAGIFVQIGLMPNSEWLKGTKVELSPRGEIEIDAHGAT
TMSGVFAAGDVTTVPYKQIIIAMGEGAKASLGAFDYLIRTPAPAKVAETA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttagaccaagcgatgaagcagcagcttaaagcatacctagaaaacttaaaaacagac
gttcagcttgtattgagccttgatgaaagcgaaacagcaagcaagctccaagcactggcg
gatgatatcgcttcactgacagacaaaatccaagtaacgcgtgacgacaacgcaagctca
cgcaaaccaattatgcaggttgtgaaccaaacacaagggacagcgattggttttgcaggc
ttgccaatgggtcacgagtttacttcactggttctcgctcttcttcacagcggcggccac
ccaatcaagctagaagcggaagtgattgagcagatcaagcagctagaccaagcactaaac
gtggaaatctttatttcactatcatgccaaaactgtcctgaagtggttcaggcgttcaac
atgatgtctgcgattaacccactaatcaacacaaccatgattgatggtgctgcattccaa
gatgaagtgaaatcacgcgatatcatggcggtgcctagtgtcttcatcaacggtgagctg
tttggtcaaggccgtatgtcattggctgagattcttaacaaagttgattccggtgcagca
gcgaaaaaagcagccagcctaaacgaacaagcaccatttgatgttttggttgttggcggt
ggtcctgcgggttcttcagcagcaatctacgcagcacgtaaaggcattcgcacaggtgtc
gtcgctgagcgtttcggtggtcaggcgatggatacgatggcgattgagaactttatctca
gtcaaagcgacaaccggtcctaagctggttgcgagtctagaagagcacgttaaagaatac
ggcgtggaagtaatgactgagcaacgcgcagccaacattatcgatgcagagcagactgaa
gatggttacatccatgttgagcttgaaagcggcgcagtactaaaagctcgcacagtgatt
accagtacaggtgcacgctggcgtgaaatgaatgttcctggtgagcaagagtatcgcaac
aaaggggttgcttactgcccacactgtgatggtccattatttaaaggcaagaaaacagcg
gtaatcggtggtggtaattcaggtattgaagcggcgattgacttagccggtattgttgaa
catgttaccgttctggagtttgcagacaccctacgtgctgaccaagttctgatcgataaa
gccaatgcgacacctaatattgaaatcatcaagatggcgcaaaccacacaagtgctaggc
gacggcaaccgtgttactggtttggaataccaagaccgcaacacaggtgagattaagaaa
atcgagttagccggtatctttgttcaaattggcctaatgccaaacagcgaatggttgaaa
ggtactaaggttgagctttcaccacgcggtgaaattgaaatcgatgcgcacggtgcaact
acgatgagcggtgtctttgctgcgggtgacgtaaccacagtgccgtacaagcaaatcatc
atcgccatgggtgagggtgctaaagcaagcttaggcgcgttcgattatctaattcgcaca
cctgctccagcaaaggttgctgaaacggcgtaa

DBGET integrated database retrieval system