KEGG   Vibrio tubiashii: IX91_03480Help
Entry
IX91_03480        CDS       T03445                                 

Definition
(GenBank) N-acetylglutamate synthase
  KO
K14682  amino-acid N-acetyltransferase [EC:2.3.1.1]
Organism
vtu  Vibrio tubiashii
Pathway
vtu00220  Arginine biosynthesis
vtu01100  Metabolic pathways
vtu01110  Biosynthesis of secondary metabolites
vtu01130  Biosynthesis of antibiotics
vtu01210  2-Oxocarboxylic acid metabolism
vtu01230  Biosynthesis of amino acids
Module
vtu_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:vtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    IX91_03480
Enzymes [BR:vtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     IX91_03480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase Acetyltransf_1 Acetyltransf_7 Acetyltransf_10
Motif
Other DBs
NCBI-ProteinID: AIW13266
UniProt: F9T924
LinkDB All DBs
Position
1:complement(730663..732000)
Genome map
AA seq 445 aa AA seqDB search
MKIRSTALVKGFRQSAPYVNAHRDKTMVIMLGGEAVADGNFSNIISDLALLHSLGVKIVL
VHGARPQINHLLQQNQYDSPYHKGIRVTDETSLNYVMQAAGQLQLTITAQLSMSLSNTPM
AGTQLNVVSGNFITSQPLGVDDGIDYCHSGRIRRIDVEGINRMLDQGSIVLLGPIASSVT
GESFNLLSEEVATQVAIKLNADKLIGFCSEQGIIDENGDVVAELFPKDAERILSRLETDR
IEGVDNSSGTLRFLRAATAACRAGVPRSHLVSYKVDGALIQELFSLDGIGTQVVKASAEQ
VRVADIDDIGGILDLIQPLEEQGVLVRRSREQLEQELHQFTIIEKDGLIIGCAALYPYPD
EKMAEMACVAIHPEYRDGNRGLLLLNHMRLQSKAQGIEHIFVLTTHSLHWFREQGFHEMG
VDFLPSQKQNLYNYQRKSKILALVL
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
gtgaagattcgaagtactgccctagtcaaagggtttagacaatctgctccttacgtcaac
gctcaccgagataagaccatggtcattatgctgggcggcgaagccgtggctgacggcaat
ttttcgaatattatcagtgatctggctctactgcatagcttaggtgtcaaaattgttctc
gttcatggagcgcgaccacaaattaatcaccttcttcagcaaaatcagtacgatagtcca
tatcacaaaggaatccgcgttacagatgagacatcccttaattacgtcatgcaagctgcc
gggcaattacagctgaccatcactgcacagctgtcgatgagcttaagcaatacccctatg
gctggaactcaactgaacgttgttagcggtaacttcattacctctcaacctctcggggtc
gacgatggtatcgactattgtcacagtggccggattcgacgcatcgatgtggaagggatc
aatcgcatgttggatcaaggttcgattgttctccttggcccgatagcaagctcagttacc
ggagagtcgtttaacctactttcagaagaggtagcaactcaggtcgccattaagctcaat
gcggacaagttaatcggcttttgttcagagcagggcatcatcgacgaaaatggtgacgtc
gttgctgaactgttcccaaaagatgcggaaagaattttatcaagacttgaaacagaccga
atcgaaggcgttgataattcctcaggcacactaaggttcttacgcgcagcgaccgcggct
tgtcgagcaggggttcctcgcagccacctagtgagctataaagttgatggtgctctgatt
caagagttgttttcactcgatggtatcggaacccaagtggtgaaagccagtgctgaacaa
gttcgtgtagccgacattgatgatattggtggcatcttagatctaattcagccactggaa
gaacaaggcgtgctagttaggcgctcacgtgaacagctggagcaagagctgcatcaattc
accatcatagaaaaagatggactgatcattggctgcgcagctctctacccgtacccagat
gaaaagatggctgaaatggcctgtgttgcgattcatcctgagtatcgtgacggcaacaga
ggcttactgctgcttaaccacatgcgtttacaatctaaggctcaggggattgaacacatc
tttgtcttaaccacccatagccttcactggtttagagagcaaggtttccatgaaatgggg
gtcgatttcctgccttcccagaagcaaaacttatacaactatcaacgaaaatcgaagatc
ttagcacttgttctctaa

DBGET integrated database retrieval system