KEGG   Vibrio tubiashii: IX91_09505Help
Entry
IX91_09505        CDS       T03445                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vtu  Vibrio tubiashii
Pathway
vtu00250  Alanine, aspartate and glutamate metabolism
vtu00410  beta-Alanine metabolism
vtu00430  Taurine and hypotaurine metabolism
vtu00650  Butanoate metabolism
vtu01100  Metabolic pathways
vtu01110  Biosynthesis of secondary metabolites
vtu01120  Microbial metabolism in diverse environments
vtu02024  Quorum sensing
Module
vtu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    IX91_09505
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    IX91_09505
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    IX91_09505
   00430 Taurine and hypotaurine metabolism
    IX91_09505
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    IX91_09505
Enzymes [BR:vtu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     IX91_09505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS AAA_33 DUF5446 OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: AIW14435
UniProt: A0A0A0SD99
LinkDB All DBs
Position
1:2054675..2056321
Genome map
AA seq 548 aa AA seqDB search
MTSEHKTADVSFESLLRIFTVPEGPDSTLTKIEEKLSRNLNKFLREHIVAEEKPLRDIEK
DFSHASIPEQPEFVSDHTQHLLDTLVSHSVHTSAPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHRLIYGESDAFYSQWMHSANHSLGAFCSGGTIANITA
LWVARNNALKATGEFKGVEKEGLFKAMKHYGYEGLAVLVSERGHYSLKKAADVLGIGQEG
LVAVKTDNNNRICPQSLQQRITELKAQNIKPFAVIGVAGTTETGSIDPLKEIAQICQKED
CHFHVDAAWGGATLMSNNYRHLLDGVELADSVTIDAHKQLYIPMGAGMVLFKQPDAMKSI
EHHAQYILRKGSKDLGSHTLEGSRSGMAMLVYAAMHIISRPGYELLIDQSIEKAKFFANH
VEQQPDFELVSEPELCLLTYRYLPKNIRIALERSTGKQTQELNELLNELTKFIQKRQRET
GKSFVSRTRLNPEKWDRLNTIVFRVVLANPLTGCDILSAVLEEQREIAKQAPKLMARIEN
LAERILAA
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgacatcggaacataaaacggctgacgtgagtttcgagagtttactccgaatcttcacc
gtcccagaaggaccagactcaacgctaaccaagatcgaagagaagttgtcgcgcaacttg
aataagtttttgcgcgagcacatcgtggcagaagaaaaaccgctgcgcgatatcgaaaaa
gacttctcacatgcgtcgattccagagcaacctgaattcgtatcagatcatacgcagcat
ctgcttgatacattagtctcccattccgttcatacctctgcgccaagctttattggtcat
atgacttcggcactgccttacttcttaatgccgttgtcgaaaatcatgatcgcgctaaac
caaaacttggtaaaaatagagacctcaaaagctttcacacctcttgaacgtcaagtttta
ggcatgcttcatcgcttaatctacggcgaaagcgacgccttttacagccaatggatgcac
agtgctaaccactcgttaggcgcattctgctccggcggaaccatcgccaacatcaccgcg
ctttgggttgctcgaaataatgcactaaaagccaccggcgagttcaaaggtgtagaaaaa
gaaggcttgttcaaggcgatgaaacattacggctatgaaggattagccgtattggtttca
gagcgtggtcactattcgctaaagaaagcggccgatgtgctaggcattggtcaagaaggc
ttagtggcagtcaaaacagacaataacaaccgaatttgcccgcaatctttacaacagcgt
atcactgagcttaaagcacaaaacatcaaaccatttgctgtgattggtgtagcgggaacg
acggaaacaggcagcatcgacccacttaaagaaatcgctcagatttgccaaaaggaagat
tgtcacttccacgttgatgcggcatggggtggtgcgactttaatgtcaaacaactatcgc
cacctactcgatggtgttgagctggcagactctgtcactatcgatgcgcacaaacagctc
tacatcccaatgggcgcaggcatggtgctgttcaaacaacctgacgcgatgaagtcgatt
gagcatcatgctcaatatattctgcgtaaaggctcaaaagatctagggagccatactctt
gaaggatctcgttcaggaatggctatgctggtgtacgcggcaatgcatatcattagtcgc
ccgggctacgaactactcatcgatcaaagtatcgagaaggcgaagttcttcgctaaccac
gttgagcaacaacctgattttgaactggtttccgaaccagagctttgcctactgacttat
cgttatctacctaaaaatattcgtatcgcactcgaacgctcaacaggcaagcagacgcaa
gaactcaacgaattgcttaacgagctaactaagtttatccagaagcgccagcgcgaaacg
ggcaaatcttttgtctcgcgtacccgcttaaatccggaaaagtgggatcgtttgaatacg
attgtcttccgcgtggtgttggctaacccattgactggctgcgatattctaagtgccgtg
cttgaagagcaaagagaaattgctaagcaagcccccaagctaatggcaagaattgagaac
ttagcagagcgtatccttgctgcttaa

DBGET integrated database retrieval system