KEGG   Vibrio tubiashii: IX91_10780Help
Entry
IX91_10780        CDS       T03445                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vtu  Vibrio tubiashii
Brite
Enzymes [BR:vtu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     IX91_10780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIW14680
UniProt: F9TCK3
LinkDB All DBs
Position
1:2347461..2348045
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKDALEPHISAETLDFHHGKHHNTYVVKLNGLIPGTEFEGKSLEEIIKTS
TGGVFNNAAQIWNHTFYWHCLAPNAGGEPTGAVADAINAAFGSFEEFKAKFTDSAINNFG
SSWTWLVKKADGSLEIVNTSNAATPLTEEGTTPLLTVDLWEHAYYIDFRNVRPDYMNAFW
ALVNWDFVAENLAK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaactaccagctcttccttacgcgaaagacgcactagaaccacatatctca
gctgaaactctagatttccaccacggtaagcaccacaacacttacgttgttaagctaaac
ggtcttattcctggcactgagtttgaaggcaaatctctagaagaaatcatcaagacttct
actggtggtgtattcaacaacgctgcacaaatctggaaccacacattctactggcactgt
ctagcgccaaacgcgggtggcgagccaacaggtgcagtagctgacgctatcaacgctgca
ttcggttctttcgaagagttcaaagcgaaattcacagactcagcgatcaacaacttcggt
tcttcttggacttggcttgttaagaaagcagacggttctctagagatcgttaacacgtct
aacgcagcaacacctctaacagaagaaggtacaactccacttcttactgttgacctatgg
gaacacgcttactacatcgatttccgtaacgttcgtccagactacatgaatgcattctgg
gcactagttaactgggacttcgttgcagaaaacctagcaaaataa

DBGET integrated database retrieval system