KEGG   Vibrio tubiashii: IX91_23555Help
Entry
IX91_23555        CDS       T03445                                 

Definition
(GenBank) xylulose 5-phosphate 3-epimerase
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
vtu  Vibrio tubiashii
Pathway
vtu00040  Pentose and glucuronate interconversions
vtu00053  Ascorbate and aldarate metabolism
vtu01100  Metabolic pathways
vtu01120  Microbial metabolism in diverse environments
Module
vtu_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:vtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    IX91_23555
   00053 Ascorbate and aldarate metabolism
    IX91_23555
Enzymes [BR:vtu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     IX91_23555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 DUF4862
Motif
Other DBs
NCBI-ProteinID: AIW17059
UniProt: F9T947
LinkDB All DBs
Position
2:complement(1747583..1748464)
Genome map
AA seq 293 aa AA seqDB search
MYQNLQRHRVGLYEKALPNELSWEEKLKTTKELGFDFLEISVDESDERRSRLDWDDETIY
ALRHQCERYGVPLQSMCLSAHRKYPFGSADPETREQALLHMEKAISLAYKLGVRTIQLAG
YDVYYEPANQATHQRFIQGMKQSAKLAERAGVMLAVEIMDTDYLNSLSKFEVLSREVDSP
YFTAYPDVGNISGWNYDIVTELKLSKPHITQIHLKDTYRVTSDYKGQFRDLVIGEGEVDF
NSIFDTLKKTDCVVPLVIEMWAQDDNWKQNIFTAQRRLNQACDHADLPKLFAA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaaaatcttcaacgccaccgagtcggtttgtatgaaaaggccctacctaacgag
ctaagttgggaagaaaagcttaaaacgaccaaagagctaggattcgattttttagagatc
tctgtggatgaatctgacgaacgtcgcagccgcttagattgggatgatgaaaccatttat
gctctgcgtcaccagtgcgaacgttatggggttcctcttcaatcgatgtgtttaagcgct
catcgcaaatacccgttcggctcagctgatcctgaaactcgcgagcaagccttactgcat
atggagaaagcgatctcattggcatacaaactaggcgtgcgtacgattcagctagcaggc
tatgatgtctattatgagccagccaatcaagcgactcaccagcggtttattcaaggaatg
aagcagtcagcgaagttggcggaaagagcgggtgtcatgcttgctgtcgagatcatggat
acagactacctaaattcattaagcaagtttgaggtgttgagccgagaagttgattcacct
tatttcacggcttatccagacgttggcaacatctctggttggaactacgatatcgtcact
gagctgaagttgagtaaaccacacattactcagatccatcttaaagatacatatcgagtg
acttcagattataaagggcaattccgcgatttggttatcggcgaaggtgaggtcgatttc
aattcgatattcgataccctcaagaagacagattgtgttgtccctctagtcattgaaatg
tgggctcaggatgataactggaagcagaatattttcactgctcagcgtcgactaaatcaa
gcttgtgatcatgctgacttgccaaagctatttgcggcttag

DBGET integrated database retrieval system