KEGG   Vigna unguiculata (cowpea): 114169833Help
Entry
114169833         CDS       T06017                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN1-like
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
vun  Vigna unguiculata (cowpea)
Pathway
vun00562  Inositol phosphate metabolism
vun01100  Metabolic pathways
vun04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:vun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    114169833
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    114169833
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vun01009]
    114169833
Enzymes [BR:vun01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     114169833
    3.1.3.48  protein-tyrosine-phosphatase
     114169833
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     114169833
Protein phosphatases and associated proteins [BR:vun01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    114169833
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase3 DSPn Y_phosphatase PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 114169833
NCBI-ProteinID: XP_027910958
LinkDB All DBs
Position
11
AA seq 115 aa AA seqDB search
MIDVEIYNLCIEESYDPAHFYGRVEAYPFDDNHVPSLQMIRDFCESVDSWLSSDPKNIVV
IHCMYYAAGKGRTGLMVCAYLTYCGMSADEALQLYADRRTTNNEGVSIPSRGILG
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgatagatgtagagatctataatctttgtatagaagaaagttatgatcctgctcacttt
tatggacgtgtggaagcatacccctttgatgataaccatgtgccatctcttcaaatgatc
agagatttctgtgaaagtgtggattcatggctgtcaagtgaccccaaaaatattgttgtt
attcattgcatgtattatgcagcaggaaaaggtagaactggattaatggtgtgtgcatac
ttaacttattgtggcatgtcagcagatgaggctcttcaactgtatgcggatagacgaaca
accaataatgaaggagtatcaataccaagtcgtggcatattgggatag

DBGET integrated database retrieval system