KEGG   Vigna unguiculata (cowpea): 114186946Help
Entry
114186946         CDS       T06017                                 

Definition
(RefSeq) uncharacterized protein LOC114186946
  KO
K17398  DNA (cytosine-5)-methyltransferase 3A [EC:2.1.1.37]
Organism
vun  Vigna unguiculata (cowpea)
Pathway
vun00270  Cysteine and methionine metabolism
vun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vun00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    114186946
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:vun03032]
    114186946
   03036 Chromosome and associated proteins [BR:vun03036]
    114186946
Enzymes [BR:vun01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     114186946
DNA replication proteins [BR:vun03032]
 Eukaryotic type
  DNA Replication Termination Factors
   DNA methylation enzymes
    114186946
Chromosome and associated proteins [BR:vun03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    114186946
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP
Motif
Other DBs
NCBI-GeneID: 114186946
NCBI-ProteinID: XP_027930830
LinkDB All DBs
Position
6
AA seq 1090 aa AA seqDB search
MTELHSQDNAPVVADSPRVSRDQKFGYSSTEEFRVRVSSDGNASSTIDRLTEENDGDRFP
GSNSGSLLSEFDEYVAAERHVSRDLGLGFEVGDMVWGKVKSHPWWPGHVYNEAFASPSVR
RLKREGHVLVAFFGDSSYGWFEPVELIPFDANFAEKSQQTNSRTFLRAVEEAVDEACRRR
GLGLSCRCRNADNFRPINVEGYFCVDVEDYEPGGLYSEGQIRKARDRFKPSETLAFVKQL
AISPHDGGRGSIGFINNKATLSAYRKAVFEQFDETYAQAFGVQPVRTTHSPNNKIDQPGI
VRHTPRAPLSGPLVIAEALGGENSKSVEFKEALKKDKYLLKRRDDPNNSVQSVYTEDKSN
AANSYLFQKRGLAVPLTLHNLEKKEDTGFVSHDVAASTSDAKEDLMGQVQADKCGLTSLS
IFSDAKALLNKGKESSDEVTLSFELDNASSKSMVRSDLSGESVVPSTVDDMCQPSDPENK
VVYAIHDGNAKLSRQREDFNQTEQGLMINAGGLNNMHQVKSENNVYGSPVEAKHHKISVV
KKIKGLKRPADELNSEASAVGQEKKKKKKKTDLNLHPTLGFPERNSTFGKSVSVKSTGKA
VSVGLASKDDLTAEQVKVDVNADNSMPMDTIGNSSLALPQLLGDLQALALNPFHGIERKI
PGAVQLFFLRFRSLVYRKSLFVSPPTEIETPEIRLTKSPTSLRTSDSPDEYVKASPIVKP
VKHVIRPAEPTKAGRKRAPSDRQEEIAAKRLKKIKDIKALASEKAVTNQKTSDARREDGM
ESFSQAPSKVVKPDTMKKVNTPAKAVEPTMLMIKFPPETTLPSIPELKARFARFGPMDPS
GFRQFWNSSTCRVVFLHKADAQAAYKYSFGNQSLFGSAGVRCFLREFGDPAPEVSEAAKG
KVDDGGSDIARVKDPPVVHRLASASSMQPLPQPIQLKSCLKKSTGDESGVITGNGSSSKG
NSRVKFMLGGEESSKGDQIMVGNRNKFNNASFADAVATDFNSKNVQKMTLQPPLPILPLP
TQFSKPPQHNLRNSELAMAPRISPNFINVTASATASTVDISQQMIHLLTRCSDVVTNLSG
LLGYVPYHPL
NT seq 3273 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaattgcactctcaagataatgcgccggttgttgcggattctcctagggtttcg
cgagatcagaaattcggctactcttcaacggaagagtttagggttagggtttcatccgac
ggaaacgcatcgtctaccatcgatagattgacggaggaaaatgacggcgatagatttccc
ggttccaatagcggatctctgttatcggaattcgacgagtacgtggcagctgagaggcac
gtgtcgcgggatctagggcttgggttcgaggttggtgacatggtgtgggggaaggtgaag
tctcatccgtggtggcctgggcacgtatacaacgaagcgtttgcgtccccgtcggtgcgt
cgcttgaagcgggaggggcatgtgttggtggcgttcttcggcgatagcagctacggctgg
ttcgaaccggtggagcttattccgttcgacgccaatttcgctgagaaatcgcagcagacg
aattcgaggacgtttctgagggccgtggaggaggcggttgatgaggcctgcaggaggcgt
gggcttgggttatcttgtaggtgtaggaatgctgataattttagacccataaatgttgaa
gggtatttttgtgttgatgtggaagattacgagcctggagggttgtattctgagggccag
attaggaaggcgagggataggtttaaaccgagtgagaccctcgcatttgtgaaacaattg
gcgatatctccacatgatggtggccgcggaagcattggattcattaacaataaggctacc
ctttcggcttatcggaaggcggtgtttgagcagtttgatgagacttatgcccaggctttt
ggtgtacagcccgtgcgcaccactcattctccgaataataaaatcgatcagcctgggatt
gttaggcacactcctagagctcctttgagtggtccactggtgattgcagaggctttgggt
ggtgagaatagcaaatctgttgaatttaaggaggctttgaagaaagataaataccttctt
aagcgaagagatgatccaaataattctgtccaatcagtctacacggaggacaaatctaat
gcagcaaatagttatctattccagaagaggggtctagctgttcctttgacacttcataat
ttagaaaaaaaagaagacactggatttgtcagtcatgatgttgcagcttcaacttcagat
gccaaagaagatttgatgggtcaggttcaagcagataaatgtggtcttacatccctttcc
attttctcagacgcaaaggctcttctcaacaagggaaaggaatcatctgacgaagtaacg
ctgagctttgaactggataatgcttcaagtaaaagcatggttaggtctgatttgtctggg
gagtcggtagtaccaagcacagttgatgacatgtgtcaaccatcggatccggagaacaaa
gttgtttatgctatacatgatgggaatgcaaaattatcaagacaacgtgaagattttaac
caaacagagcagggactcatgatcaatgctggtggattaaataacatgcatcaagttaaa
agcgaaaataatgtatatggttcaccagttgaagcaaagcatcacaaaattagtgtggtg
aagaagattaaaggtcttaagagacctgcagatgagttgaattctgaagcttctgctgtt
ggacaggaaaagaagaaaaagaaaaagaaaacagatttaaatttacatcctaccttaggc
tttccagagagaaattctacatttgggaaatcagtttctgtaaaatcaactggaaaagct
gtctcagttggtttggcttctaaagatgatttaactgcagaacaagtgaaggtagatgtt
aatgccgataattcgatgcccatggataccataggaaattctagtttagctttgccccaa
cttttgggtgatttgcaggcccttgctttgaacccttttcatggcattgaaagaaagatc
cctggagctgttcagctgttctttctgcgattcaggtctcttgtttaccgaaaaagcttg
tttgtatctccaccaactgagattgaaactcctgaaatccgcctcacaaaatctcctaca
agtctcaggacatctgacagtcctgatgagtatgtcaaagcttcaccgattgtaaaacca
gtgaaacatgtcattcggcctgctgagcccacaaaagcagggcggaaaagggcaccctct
gatcggcaagaggaaattgctgccaagaggttgaagaaaatcaaagatataaaggcacta
gcttcagaaaaggcagtgaccaatcagaaaacttctgatgcccggcgagaagatggcatg
gaatccttttctcaggctccatccaaggtagtgaaaccagacacaatgaagaaagtgaac
actccagctaaggcagttgagcccacaatgttgatgatcaaatttcctcctgaaacaact
cttccgtctattccagagctgaaagcaaggtttgctcgctttggcccaatggatccatcg
ggtttccgtcaattttggaactcatcaacttgtcgagttgttttcttgcacaaggctgat
gcacaagctgcctataaatactcttttggaaatcaatccttatttggaagtgcgggtgta
aggtgtttccttagggaatttggggatcctgctccggaagtgtccgaagctgcaaagggt
aaggtagatgatggtggaagtgacatagctcgggtgaaggatcccccagtggttcatcgc
ctggcatcagcatcatctatgcaaccacttcctcagcccatccagctgaagtcgtgcctg
aagaaatctacaggtgatgagtcgggtgtgattacgggtaatggaagtagtagtaaagga
aactctcgtgtaaaattcatgttaggtggggaagaaagtagtaagggagaccaaataatg
gtgggtaatagaaacaagttcaacaatgctagctttgctgatgctgttgcaacggatttt
aatagtaagaatgttcaaaagatgacattacaacccccgttgcctattcttcctcttcct
acacagttttcgaaaccccctcaacataatttgcgtaattctgaattggcaatggcaccc
cgaatcagtccgaattttattaacgtcacagcatcagctactgcaagcacggttgatata
tcacagcaaatgatacaccttttgactaggtgcagtgatgttgtcactaacttgtcgggt
ttattgggctatgtgccttaccatccgctctga

DBGET integrated database retrieval system