KEGG   Vigna unguiculata (cowpea): 114187662Help
Entry
114187662         CDS       T06017                                 

Definition
(RefSeq) uncharacterized protein LOC114187662
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
vun  Vigna unguiculata (cowpea)
Pathway
vun00061  Fatty acid biosynthesis
vun00780  Biotin metabolism
vun01100  Metabolic pathways
vun01212  Fatty acid metabolism
Module
vun_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:vun00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    114187662
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    114187662
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:vun01004]
    114187662
Enzymes [BR:vun01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     114187662
Lipid biosynthesis proteins [BR:vun01004]
 Fatty acid synthase
  Component type
   114187662
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT MaoC_dehydrat_N
Motif
Other DBs
NCBI-GeneID: 114187662
NCBI-ProteinID: XP_027931770
LinkDB All DBs
Position
6
AA seq 218 aa AA seqDB search
MAASAFSNALLSPVTLPSKPKSISFQHRFPLLKFPSTRSHPSLSKTTTFCSSDAANAPQN
DTPIELRYPAFPTVMDINQIRDILPHRFPFLLVDRVIEYNPGVSAVAIKNVTINDNFFPG
HFPERPIMPGVLMVEAMAQVGGLVMLQPEVGGSRENFFFAGIDKVRFRKPVIAGDTLVMR
MTLTKLQKRFGIAKMDGKAYVGGEVVCEGEFLMAMGSE
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctctgctttctccaacgcattactttctcccgtaactcttccttccaaaccc
aaatccatttcctttcaacacagattcccacttctcaaattccccagcaccagatcccac
ccctcgttgagcaaaacgaccacgttttgttcctcggatgccgccaatgctcctcaaaat
gacaccccaattgaattaaggtatccggcatttccaacagtcatggatatcaaccagatt
cgtgacattttaccccacaggtttcctttccttctggtggatagagtgattgagtacaac
cctggcgtttctgctgtcgctataaagaatgtgacaataaatgacaatttctttcctgga
cattttccagaaaggcccatcatgccaggtgttctcatggttgaggcaatggcacaagtt
ggcggtttggtcatgttgcaacctgaagtgggaggttctcgtgaaaacttcttctttgct
ggaattgacaaagtgcgatttcgtaagccagtgattgcaggggacaccttagttatgaga
atgacgcttactaagctgcaaaagcgatttggaatagcaaagatggatgggaaggcatat
gttggaggtgaagttgtgtgtgagggtgaatttttgatggcgatggggagtgaataa

DBGET integrated database retrieval system