KEGG   Vitis vinifera (wine grape): 100233100Help
Entry
100233100         CDS       T01084                                 

Gene name
SODCP, CSD2
Definition
(RefSeq) Cu/Zn superoxide dismutase-like
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100233100 (SODCP)
Enzymes [BR:vvi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100233100 (SODCP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 100233100
NCBI-ProteinID: NP_001268067
UniProt: K4HWD0
LinkDB All DBs
Position
6
AA seq 221 aa AA seqDB search
MQAAAVLAAMAVHTLLSTAPSRVFLSFPNPSPNPSPQLHSQFHGLSLKLTRQSIPLATAP
KPLSVVAVTKKAVAVLKGTSSVEGVVTLSQEDDGPTTVSVRITGLTPGNHGFHLHEFGDT
TNGCMSTGAHFNPNGMTHGAPEDDVRHAGDLGNIVANAEGVAEATIVDTQIPLSGPNAVI
GRALVVHELEDDLGKGGHELSLTTGNAGGRLACGVVGLTPI
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctgcggctgtattggctgcgatggctgttcacacgctactctccactgctcca
tctcgtgtttttctctctttccctaaccctagccccaaccctagtcctcagctccattcc
caattccatggcctctccctcaaactcactcgccaatccatacccctcgccaccgctccc
aagcccctctccgtggtcgccgtcaccaagaaagccgtcgctgtcctcaagggaacctcc
tccgttgaaggcgtcgtcaccttgagtcaagaggacgatggcccaacgactgtctctgtt
cggattaccgggcttactccagggaatcatgggttccatctacatgagtttggtgacacg
acaaatgggtgcatgtcaacaggagcacatttcaatccaaatgggatgacacatggtgct
cctgaagatgatgtccgtcatgcgggtgacctgggaaacatagttgccaatgctgaaggg
gtggctgaagcaacaattgtggatacccagataccattaagtggacctaatgcagtgatt
ggaagagccttggtggttcatgaacttgaggatgaccttgggaagggtgggcatgaactt
agccttaccactggcaatgcaggtggaagattggcatgtggtgttgttggccttactccg
atatga

DBGET integrated database retrieval system