KEGG   Vitis vinifera (wine grape): 100241809Help
Entry
100241809         CDS       T01084                                 

Gene name
CSD1
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100241809 (CSD1)
Enzymes [BR:vvi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100241809 (CSD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 100241809
NCBI-ProteinID: XP_002268436
LinkDB All DBs
Position
14
AA seq 152 aa AA seqDB search
MVKAVAVLNSNEGACGTIYFAEEGDGSTTVTGSLSGLKPGLHGFHVHALGDTTNGCMSTG
PHFNPAGKEHGAPEDENRHAGDLGNVIVGEDGTVNFKIVDKQIPLTGSNSIVGRAVVVHA
DPDDLGKGGHELSKSTGNAGGRVACGVIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggctgttgctgttcttaacagtaatgagggtgcttgtggaactatctacttt
gctgaagaaggagatggttcgactacagtgactgggagtctttctggccttaagcctgga
cttcatggcttccatgtgcatgcccttggggacacaacaaatggttgcatgtcaactgga
cctcatttcaatcctgctggaaaagagcatggtgctcctgaagacgagaatcgtcatgct
ggtgatttaggaaatgtcattgttggtgaggatggtactgttaatttcaaaattgttgac
aagcagattcctctcactggatcaaactccattgttggaagggctgttgttgtccatgct
gatcctgatgatcttggaaaggggggacatgagctcagcaaaagcacgggaaatgctggt
ggcagagtagcctgtggagttatcggattgcaaggctaa

DBGET integrated database retrieval system