KEGG   Vitis vinifera (wine grape): 100244316Help
Entry
100244316         CDS       T01084                                 

Definition
(RefSeq) DNA excision repair protein ERCC-1
  KO
K10849  DNA excision repair protein ERCC-1
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    100244316
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:vvi03400]
    100244316
DNA repair and recombination proteins [BR:vvi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     100244316
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad10 HHH_5 HHH_2 HHH HRDC CAP_N
Motif
Other DBs
NCBI-GeneID: 100244316
NCBI-ProteinID: XP_002281063
UniProt: D7U1X7
LinkDB All DBs
Position
14
AA seq 398 aa AA seqDB search
MNKEEEEKQRERDDEKKNKSSIVIKIPSYQEVLESSQSKTTSSLFTPSPSFSQAFSFVKS
SQSYTPPPPATPPPPPPPSSRQVEQLEAPSSSSSSPSLSRSAQSRNAILVSHRQKGNPLL
KHIRNVRWDFADIVCDYLLGQNSCALYLSLRYHLLHPDYLYYRIRELQKNFKLRVVLCHV
DVEDVIKPLLEVTRTALLHDCTLLCAWSLEECGRYLETIKVYENKSADIIQGQTDTDYLS
RLTHALTTVRHVNKTDVVTLGSTFGSLSHIMDASMEDLARCPGIGERKVKRLYDTFHEPF
KRVVPSCPAVPENPVHNNAEPSSVNEVVEVENDVEDASKRRKKEPELTVKSALSAAFAQY
SEKIGKRNNRPQGKKHEEKGHAPETKAENKPSDEGAAS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagaagaagaagaaaagcagagagaaagagatgacgagaagaagaacaaaagc
tcgatagtaataaagataccttcataccaagaagttctggagagctctcaatccaaaacc
acctcgtctctcttcactccttccccttctttctctcaggccttctccttcgtcaaatcc
tcccaatcctacactcctcctcctcctgctactcctcctcctccaccccctccctcttcc
aggcaagttgagcaattggaggctccttcttcgtcttcttcttcgccttcgttgtcgagg
tctgctcagagtcgcaatgcaattcttgtgagccataggcagaagggaaatcccttgctc
aaacacatcaggaatgtgaggtgggattttgcagatattgtttgtgactacctgcttggg
cagaactcctgtgcactctatctaagtcttcggtatcatctgcttcatcctgactaccta
tactatcgtataagagaattgcagaagaacttcaagcttcgtgttgttttatgccatgtt
gatgtggaggatgttattaaacctttacttgaagtcactagaacagctctacttcatgat
tgcacccttttgtgtgcttggagcttggaagaatgtgggcggtacttggagacaattaaa
gtctacgaaaacaagtctgcagacattattcaaggacaaacagatacagactatttatca
cggctaactcatgctctaacaacagttcgacatgttaacaagactgatgtagttaccctt
ggttccacatttgggtctctttctcatatcatggatgcatcgatggaagatctagctcgt
tgccctggtataggggagcgcaaggtaaaacgtttatatgacacatttcatgaaccattc
aagcgagtagttcccagctgccctgctgttccagaaaatcctgttcacaacaatgctgaa
ccttcctctgtgaatgaagttgttgaagttgaaaatgatgtggaagatgcaagtaaacgt
agaaagaaagaacctgaattgaccgttaaatcagccctgtctgctgcttttgctcagtac
tcagagaaaattggtaaaaggaacaatagaccacaagggaagaagcatgaagaaaaaggt
catgccccagaaacaaaagcggaaaataagccatctgatgaaggggctgcaagctaa

DBGET integrated database retrieval system