KEGG   Vitis vinifera (wine grape): 100248004Help
Entry
100248004         CDS       T01084                                 

Definition
(RefSeq) transketolase, chloroplastic
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00030  Pentose phosphate pathway
vvi00710  Carbon fixation in photosynthetic organisms
vvi01100  Metabolic pathways
vvi01110  Biosynthesis of secondary metabolites
vvi01200  Carbon metabolism
vvi01230  Biosynthesis of amino acids
Module
vvi_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
vvi_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
vvi_M00165  Reductive pentose phosphate cycle (Calvin cycle)
vvi_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
vvi_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100248004
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100248004
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    100248004
Enzymes [BR:vvi01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     100248004
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C KfrA_N
Motif
Other DBs
NCBI-GeneID: 100248004
NCBI-ProteinID: XP_002266494
UniProt: F6HAM6
LinkDB All DBs
Position
16
AA seq 729 aa AA seqDB search
MAAASASSSLYLLPRTLNHHSSTPHPNRLSLSGLTPKTQALRTRHGRRARATVRAAAVET
LQKADTSLVEKSINTIRFLSIDAVEKANSGHPGLPMGCAPMGHILYDEVMRYNPSNPYWF
NRDRFVLSAGHGCMLQYALLHLAGYDSVKEEDLKSFRQWGSRTPGHPENFETPGVEVTTG
PLGQGIANAVGLAAVEKHLAARFNKPDNEIVDHYTYVILGDGCQMEGISNEVCSLAGHWG
LGKLIAFYDDNHISIDGDTEIAFTESVDTRFEGLGWHVIWVKNGNTGYDEIRAAIKEAKA
VKDKPTLIKVTTTIGYGSPNKANSYSVHGSALGAKEVDATRKNLGWPHEPFHVPEDVKKH
WSRHIPDGAALEAEWNAKFAEYEKKYKEEAAELKSIITGELPAGWDKALPTYTPESAADA
TRNLSQQCLNALAKVLPGLLGGSADLASSNMTLLKMFGDFQKGTPEERNVRFGVREHGMG
AICNGIALHSLGLIPYCATFFVFTDYMRAAIRISALSEAGVIYVMTHDSIGLGEDGPTHQ
PIEHLASFRAMPNILMLRPADGNETAGAYKVAVVNRKRPSILALSRQKLPQLPGTSIAGV
EKGGYAISDNSSGNKPDVILIGTGSELEIAAKAGDELRKEGKTVRVVSLVSWELFDDQSD
AYKESVLPAAVTARVSIEAGSTFGWEKIVGSKGKAIGIDRFGASAPAGKIYKEFGITVEA
VIEAAKAVW
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgcttctgcttcgtcatcgctctatctcctcccccgcaccctcaaccaccac
agctccaccccacaccccaaccgcctctccctgtcgggtctcaccccaaagacacaggct
ttacgcacccgccatggaaggcgcgcaagggccaccgttagggcggcggcggtggagacg
ctccagaaggcggacacgtctctggtggagaagtcgatcaacacgataagatttctgtcg
atagacgcagtggagaaggcgaattccggtcacccaggtctgcccatggggtgtgctccc
atgggtcatatactgtacgatgaggtcatgaggtacaacccctccaacccctactggttc
aatcgtgatcgattcgttctctccgctggccacggctgtatgttgcagtatgctttactt
catcttgctggctatgacagtgttaaggaagaggatttgaagtctttccgacaatgggga
agtagaactcctggtcacccagagaacttcgagacacctggggttgaagtgacaactggc
cctcttggtcagggtattgccaatgctgttggtttggccgctgtggagaagcatttggct
gcaagattcaacaaacctgacaatgagattgtcgaccactacacgtatgtgatacttggt
gatggatgtcaaatggaaggaatttcaaatgaagtttgttcccttgctgggcactggggg
cttgggaagctgattgcattttatgatgataaccacatttcaattgatggtgacactgaa
attgcatttactgaaagtgttgacacccgttttgagggacttgggtggcatgtgatttgg
gtgaagaatggtaacactgggtatgatgaaattcgtgctgccatcaaggaagcaaaggct
gttaaagacaagcccacattgattaaggtgacaactaccattggttatggttctcctaac
aaggcaaactcatatagtgttcatgggagtgcattgggtgctaaagaagtagatgcaaca
aggaagaaccttggttggcctcacgagccattccacgtgccagaggatgtcaaaaagcac
tggagccgccacatccctgatggagctgcccttgaagctgaatggaatgccaagtttgca
gagtatgagaagaaatacaaagaagaagcagcagaattaaagtccatcatcactggtgaa
ctacctgctggttgggataaagcacttccgacttacactcctgaaagtgctgctgatgct
accagaaatctgtctcaacaatgtcttaatgctctggccaaagttcttcctgggctccta
ggtggcagtgcagatcttgcttcctccaacatgactttgctgaaaatgtttggtgacttc
caaaaaggcacccctgaagagcgaaatgtccgttttggtgtcagggagcacggaatgggt
gccatctgcaatggaattgctctgcacagccttggccttattccctactgtgcgaccttc
tttgttttcaccgactacatgagggccgccattaggatttctgccttaagtgaagctgga
gttatttatgtgatgacccatgattcaattgggcttggagaggatggaccaactcatcaa
ccaattgagcatctggcaagcttcagagccatgccaaatattctaatgctccgtcctgct
gatggaaatgagactgctggtgcatataaggttgcagttgttaacagaaagagaccctcg
attcttgctctctcacgtcaaaagcttcctcagcttcctggaacatccattgcaggagtt
gagaaaggaggttacgccatttctgacaattcttcaggcaataagccagatgttattttg
attggaactgggtccgaattggagattgctgccaaggcaggagatgagctgaggaaggaa
ggaaagactgtaagggtggtatccctggtttcctgggagttgtttgatgaccagtccgat
gcatacaaggaaagtgtcctcccagctgctgtaacagctagagtcagtattgaagcagga
tccacatttggatgggagaagattgtaggaagcaagggaaaggcgattggcattgaccga
tttggagcaagtgcaccagcaggaaagatctacaaggagtttggaattacagtggaggct
gtaattgaagcagctaaggcagtttggtag

DBGET integrated database retrieval system