KEGG   Vitis vinifera (wine grape): 100249229Help
Entry
100249229         CDS       T01084                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100249229
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:vvi03036]
    100249229
Enzymes [BR:vvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100249229
Chromosome and associated proteins [BR:vvi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100249229
   Polycomb group proteins
    PRC2-EZH2 complex
     100249229
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 100249229
NCBI-ProteinID: XP_010652795
LinkDB All DBs
Position
7
AA seq 934 aa AA seqDB search
MSSKPSLSASASASGSRSEHSKDPTTNKLPETSPIPRDISSVIDSLKKQALADRCVSIKE
RMEENRQRLVGITKHLHKLSEERRNNRNSDIDKSVDLLTKRQRDALDMQNGNDANNGDKA
SHCSQEDGHVSSAVLLGSSIAVKNAVRPIKLTEVKRLPPYTTWIFLDRNQRMTEDQSVVG
RRRIYYDQTGGEALICSDSEEEAIEEEEEKKEFADFEDYILRMTIKETGLSDPVLEALGR
YLSRKPCEVKARYEILNKGEKSVVGSKNGVIEDISQTLTSYLDKDLDAALDSFDNLFCRR
CLVFDCRLHGCSQDLVSPAEKQLPWNHLDEDNIPCGAHCYRLAVKSESIGMVSSPVCADF
EDKTAPSSDGAGPHLSSRKNCGPSSKRRAKSCQSESASSNGKNISESSDSEIRPKQDTTS
THHSSSPPKTRLVGKCAIRKRNSKRVAERVLVCMRKRQKMVASDSDSILSGRLWPRDMKL
RSNSRKENEDASSSSLKKVKPSITGRSRRKCSPVQDSNKLVEGEVPEGQMNEMINDPPAS
SSDDTLRKEEFVDESMCKQERSDDKSWKAIEKGFFEKGVEIFGRNSCLIARNLLNGMKTC
LEVFQFMNCSENKPFFRAGDGSNSMVEGYSKVDFNETMGNEVRRRSRFLRRRGRVRRLKY
TWKSAGYHSIRKRISERKDQPCRQYNPCGCQSACGKQCACLLNGTCCEKYCGCPKSCKNR
FRGCHCAKSQCRSRQCPCFAADRECDPDVCRNCWISCGDGTLGVPSQRGDNYECRNMKLL
LKQQQRVLLGRSDVSGWGAFLKNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLF
NLNDQFVLDAYRKGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERISAGEELFYDYR
YEPDRAPAWARKPEASGVKKEDVAPSSGRAKKLA
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccaagccgtcgctctccgcttccgcttccgcttctggtagcagatcggagcat
tccaaggatcctacgacgaataaactaccagaaacaagtccgattcccagggacatttca
tcagtcattgattctttaaaaaaacaggctcttgctgaccggtgtgtttccataaaggaa
agaatggaagaaaacaggcagaggttggttggtatcacaaaacatcttcataaattgtca
gaggaaagaagaaacaacaggaatagtgatattgacaaaagtgtagatctattaacgaag
aggcaaagagatgcacttgatatgcaaaatggtaatgatgcaaataatggggataaggct
agccattgttcccaagaagatggacatgtgtcttcagcagttctcctaggatctagtatt
gcggtcaagaatgctgttcgccctatcaaacttactgaagtgaaaagattgcctccttat
accacatggattttcttggacagaaatcaaagaatgacagaggatcagtcagtagttggt
cgtaggagaatttattatgaccaaactggtggtgaagctttaatttgcagtgacagtgag
gaggaagctattgaagaagaagaagaaaagaaagagtttgcagattttgaggattatata
cttcgaatgaccatcaaagaaactggtttatctgatcctgtgcttgaggcattggggcgg
tatctttctagaaaaccttgcgaagtcaaggcaagatatgaaattcttaataagggagag
aagtctgtggtgggctctaagaatggggtgatcgaagacatttcacaaactttgacttct
tatcttgataaagatcttgatgcagctctggattcttttgataacctattttgccgtcga
tgtcttgtctttgattgtagattgcatggatgctcacaggatctcgtctctccagctgag
aaacaacttccatggaatcatcttgatgaggacaatataccatgtggcgcacattgttat
cgattggctgtgaagtctgaaagcattggtatggtgagctctcctgtgtgtgctgatttt
gaagacaaaaccgctccttcatctgatggtgctgggcctcatttatcatctagaaagaac
tgtggtccatctagtaaaaggagggcaaagtcctgccaaagtgaaagcgcttcatcaaat
ggaaaaaacatatctgaaagcagtgactcagagattagaccgaagcaggacaccacctct
actcatcactcttcatccccacccaagactagacttgttggaaaatgtgcaattcgtaag
agaaacagcaagcgagttgctgagcgtgttctggtttgcatgcggaaaaggcagaaaatg
gtggcttcggattctgattccattttgagtggacggctttggcctagagatatgaaactt
agatctaattcacgtaaagagaatgaagatgctagttcttcttcactgaaaaaggtgaaa
ccttcaatcactggaaggtctaggaggaagtgttcgccagtccaggacagtaacaaattg
gtggaaggtgaagttcctgagggccaaatgaacgagatgattaatgatccgcctgcaagt
agcagtgatgacacattgaggaaagaagaatttgtagatgaaagcatgtgtaaacaagaa
agaagtgatgataaatcctggaaagcaattgaaaaaggcttttttgagaaaggtgtagaa
atttttggcaggaacagctgcttaatagctaggaaccttctcaatggtatgaagacatgt
ttggaggtatttcaatttatgaattgctctgaaaataagccattcttccgagctggggat
ggttccaattctatggttgaaggctattctaaggttgactttaatgaaactatgggtaat
gaagtaagaagaagatcaagatttttacgcaggcggggtagagttcgccgcttgaagtat
acttggaaatctgccggttaccattcaattaggaaacgcatatctgagagaaaagatcag
ccttgtcggcagtacaacccatgtggttgccaatctgcatgtggaaagcagtgtgcttgt
cttctaaatgggacatgctgtgaaaaatactgtggatgccctaagagttgcaagaatcga
tttagaggttgccattgtgccaaaagtcagtgccgaagtcgtcaatgtccatgctttgcg
gcagacagggaatgtgatccagatgtttgtcggaattgctggatcagttgtggtgatggt
actcttggtgtaccaagccaaagaggtgataattatgaatgtagaaatatgaagcttctt
ctcaaacagcaacaaagggttctgcttgggaggtctgatgtatctggttggggagcgttc
ttaaagaatagtgtgggcaaacatgaatatcttggtgagtacactggagaactgatttca
cacagggaagcagataagcgtggaaagatttatgaccgtgaaaattcttcgtttctcttt
aatctgaatgatcagtttgttcttgatgcctatagaaaaggtgacaaattgaagtttgcc
aaccattctccagatcctaattgctatgcaaaggtgattatggtcgcaggggatcacagg
gttggcatatttgccaaggaacgaattagcgcaggagaggaactcttttatgattaccgt
tatgagccagatagagctcctgcatgggctaggaagccagaggcgtctggtgtgaagaaa
gaggatgttgctccttctagtggccgtgctaaaaagcttgcttaa

DBGET integrated database retrieval system