KEGG   Vitis vinifera (wine grape): 100249755Help
Entry
100249755         CDS       T01084                                 

Definition
(RefSeq) probable RNA polymerase II transcription factor B subunit 1-1
  KO
K03141  transcription initiation factor TFIIH subunit 1
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi03022  Basal transcription factors
vvi03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    100249755
  09124 Replication and repair
   03420 Nucleotide excision repair
    100249755
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:vvi03021]
    100249755
   03400 DNA repair and recombination proteins [BR:vvi03400]
    100249755
Transcription machinery [BR:vvi03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100249755
DNA repair and recombination proteins [BR:vvi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     100249755
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BSD PH_TFIIH SAB SHOCT
Motif
Other DBs
NCBI-GeneID: 100249755
NCBI-ProteinID: XP_002276057
UniProt: D7UAQ6
LinkDB All DBs
Position
19
AA seq 602 aa AA seqDB search
MSGEVLKRARYKTSVKDSGVAGVLKMTEDKFVFMPNDPTSSARFDVEFRFIKGHKFSKGG
SNKPALLNLTQDSEKGGGYIFEFENYPDREVCREFVGRALAKFSEASKAGSEQSAVKLFD
EQLSTIEMERRIKLLREDSELQKLHKQFVLSGVLTEAEFWATRKKLLDGNTSRTSKQRVG
FKSAMISDLKPLTDGRTNRVTFNLTPEIIHQIFAEKPAVHQAFLNFVPNKMTEKDFWNKY
CRAEYLHCTRNTVAAAAEAAEDEELAVFLKHDDILANEARRKIRRVDPTLDMEADQGDDY
MHLPDHGIFRDGSKEIIDPQYEQYRRTLSQDLNRHAAVVLEGRPIDVELEDTRTVAEALA
KSKRVEAANEKSDGSVTRERLERISRMTEIEDLQAPRDLPFAALCIKDPRDYFDSQQANA
LKTLGDTLAGSKQIKCSLSTQEAYGSLRGFISEIKSVGLSDPIVKPDIALKVLNGLTQNI
SSTKFHLGKNPQESVLDRLPIITKEELLHHWTSIQELLRHFWSSYPITTTYLYTKASRLK
DAMSQIYPKLQEIKESVQSDFRHQVSLLVQPMLQALDAAFAHYDADQQKRSARSGERPNG
FV
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcgaggtcctgaagcgtgctaggtacaagacgtcagtcaaggactctggagtt
gcgggtgttctgaaaatgactgaggacaaatttgtattcatgcctaatgaccccacatca
tctgcaaggttcgatgttgagtttcggttcattaaaggtcacaaatttagcaagggggga
tcaaataaacctgcattgcttaatctcacacaagattccgaaaagggtggaggttacatt
tttgagtttgaaaactatccagaccgtgaagtttgccgagaatttgtgggcagagccctt
gcaaaattcagtgaggcttcaaaagctggttctgaacaatctgcggttaaactttttgat
gagcaacttagtaccatagaaatggagcgccggataaagctactgcgagaggatagtgag
ttgcagaaacttcataagcaatttgtactcagtggtgtcttgacagaagctgaattttgg
gcaactaggaagaaattgctggatgggaatactagtagaacttcaaaacaacgtgtggga
ttcaaaagtgccatgatatcggatcttaaaccattgactgatggtcggacaaacagagtt
acatttaacttgacaccagaaataattcatcagatttttgctgagaaaccagctgttcat
caggcatttttgaattttgttcccaataagatgacagaaaaggacttctggaacaaatat
tgtagagccgaataccttcattgtacgagaaacacagttgctgctgcagcagaggctgct
gaagatgaggaacttgctgttttcttgaagcatgatgatatattggccaatgaagctcgg
cggaagatcagacgggttgatccaactttggacatggaggctgaccagggggatgattat
atgcatcttccggatcatggtatctttcgtgatggtagcaaggaaattattgacccacaa
tatgagcaatatagaaggactctttcacaagaccttaatcggcatgctgcagttgttctt
gaaggaagacctatagatgtggagttggaagacacaagaactgtagcagaggctcttgcc
aagtcgaaacgggttgaggcagctaatgaaaaatctgatgggagtgtaacccgggaaaga
ttagaaaggatttctcggatgactgagattgaggatcttcaggcacctcgtgaccttcca
tttgcagcactttgcattaaggatcctcgtgactattttgattcccaacaagcgaatgca
ttaaaaactttgggagacaccctagccggatcaaagcaaataaaatgcagcctgagcacc
caggaagcatatggttctttgagaggatttatttctgagatcaaatctgtaggattaagt
gatcccatagttaaacctgatattgctcttaaggttcttaatgggttgacccagaatatc
tcaagtaccaagttccatcttgggaagaatcctcaagaaagcgttctggatagattgcca
atcattactaaagaggaattgctacatcattggacctcaattcaagaattactgagacat
ttctggtcgtcatatccaattacaactacatatctttatactaaggcaagcaggctaaaa
gatgccatgtctcaaatttatccaaagctacaggagataaaggaatctgtgcagtctgat
tttaggcatcaagtttccctccttgttcaaccaatgcttcaggctctagatgctgctttt
gcacattatgatgcagaccaacagaagagatcagcgcgaagtggagaaagacccaatgga
tttgtctag

DBGET integrated database retrieval system