KEGG   Vitis vinifera (wine grape): 100250074Help
Entry
100250074         CDS       T01084                                 

Definition
(RefSeq) histone deacetylase 5
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
vvi  Vitis vinifera (wine grape)
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vvi01009]
    100250074
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:vvi03019]
    100250074
   04131 Membrane trafficking [BR:vvi04131]
    100250074
   03036 Chromosome and associated proteins [BR:vvi03036]
    100250074
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100250074
Protein phosphatases and associated proteins [BR:vvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100250074
Messenger RNA biogenesis [BR:vvi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100250074
Membrane trafficking [BR:vvi04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    100250074
Chromosome and associated proteins [BR:vvi03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100250074
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 100250074
NCBI-ProteinID: XP_002280859
UniProt: D7SI14
LinkDB All DBs
Position
17
AA seq 646 aa AA seqDB search
MEVNSEKGDRRRRVGLVYDDRMCEHATADGDPHPENPDRIRAIWKKLESAGIPQRCVVFN
AKEAEDKHILSVHSNNHVNLIKNISSKQFDSRRNRIASKFNSIYMNEGSSEAAYLAAGSV
IEVAERVAKGELSSAFAIVRPPGHHAEQNEPMGFCLYNNVAIATSFLLNERPDIKKILIV
DWDVHHGNGTQKMFWKDPRVLFFSVHRHEFGSFYPANDEGFYAMTGEGPGAGYNINVPWE
NGRCGDADYLAVWDHILIPVAKDFNPDIVIISAGFDAAIGDPLGGCHVTPYGYSVMLKKL
MEFSEGKIIMALEGGYNLVSLANSVLACVEVLLEDKPIAGSSEAYPFESTWRVIQAVRQE
LSAFWPTLADELPKKLTSCKASPLQLLVASSDSEDESDIDLHIRAENLEAVVQDGLSKLK
VDEDSHDLVATWRSELSKIDVWYASFGSNMWKSRFLCYIEGGQLEGMEKRCSGSVDRNPP
KEIMWKTVPHRLFFGRDHSSTWGPGGVAFLNPEENNQDRAYICLYRITLEQFNDVLLQEN
ASSYDISSPLFDLVALNSIADKQSISVEFKSGWYRSVLYLGKECDIPILTLTCPLSDVEA
FKSGDLPMSAPSKEYANTIIRGLTEGKQLSEEEAIAYIQEASTKPL
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgaactccgagaaaggcgatcgtcggcgacgcgtgggcctcgtctacgatgat
cgtatgtgtgagcatgccacagcagatggtgatcctcaccccgagaatcccgatcggatt
agggccatctggaagaagctcgaaagcgctggaattcctcagagatgtgtggttttcaat
gctaaagaagcagaagataaacatatactatcagttcacagcaataatcatgtcaatttg
attaaaaacattagctccaaacaatttgattcaagaagaaataggattgcgtcaaagttt
aattccatctatatgaatgaaggctcatcggaggctgcttatcttgctgctggctctgtg
attgaggttgctgagagggtcgccaaaggggagttgagttctgcttttgccattgttagg
cctcctggacatcatgcagagcaaaatgagccaatgggattttgtctatacaacaatgtg
gctattgcaacaagttttctcttgaatgaaagaccggacattaaaaaaatcctgattgtt
gattgggatgttcatcatggtaatggcactcaaaagatgttctggaaggatcctcgagtt
ctatttttttctgttcataggcatgagtttgggagtttttatcccgcaaacgatgaaggt
ttttatgctatgactggagaaggaccaggtgctggatacaatataaatgttccttgggag
aatggacgatgtggtgatgctgattatctcgccgtttgggaccatatattaattcctgtt
gccaaggattttaatccagacattgttataatctctgcaggatttgatgcagcaattggt
gatcccttgggggggtgtcatgtcacaccatatggatattctgttatgttgaaaaagctg
atggagttttctgaaggaaagattataatggcattagaaggtggatacaatcttgtctct
ttagcaaattcagttcttgcatgtgttgaggttttgctagaagacaagcctattgctgga
tcttcagaggcctatccattcgagtcaacatggcgtgtaatacaagcagttcgccaagaa
ttgagtgcattctggccaactcttgcagatgaattaccaaagaagctaaccagttgtaaa
gcatctccacttcagcttctggtcgcaagctctgattctgaagatgaaagtgacatagat
ctgcatattagagcagaaaatcttgaggcagttgttcaggatggcctttcaaaactgaaa
gttgatgaagatagtcatgatctggtggccacctggagatcagagttgtcaaaaattgat
gtttggtatgcctcttttggatcgaatatgtggaaatcaagatttctgtgctacattgaa
ggtggacagttggaaggtatggaaaagcgatgttccggttcagtggatagaaacccacca
aaagagattatgtggaagactgtccctcatcgtttattctttggtcgtgatcattccagc
acatggggtcctggaggggttgctttccttaatcctgaagaaaacaatcaggacagagct
tacatttgcctatatagaattactcttgaacagttcaacgatgttctgcttcaggagaat
gcttcaagttatgacatcagttctcctttgtttgatttagtggctttaaactctattgct
gacaaacagtctatctctgtggagttcaagtcgggctggtatcgtagcgtcctttatttg
ggaaaggagtgtgatattccaattctgactctcacatgcccactttcagatgttgaggcc
ttcaaatcgggagaccttcccatgagtgctccaagcaaagaatatgccaacaccataata
agaggcctgacagaaggaaaacagctctcagaagaagaagccattgcttacatacaggaa
gcttctacaaagccattgtga

DBGET integrated database retrieval system