KEGG   Vitis vinifera (wine grape): 100250317Help
Entry
100250317         CDS       T01084                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00500  Starch and sucrose metabolism
vvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100250317
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     100250317
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-GeneID: 100250317
NCBI-ProteinID: XP_002282184
UniProt: D7TPJ1
LinkDB All DBs
Position
3
AA seq 425 aa AA seqDB search
MDIATSLSCLLFFITILPALTASPILFQGFNWESSKKEGGWYNFLINSIPELAASGITHV
WLPPPSQSVSPEGYMPGRLYDLNASKYGTQDELKTLIKVFHSKGVQCIADIVINHRTAEK
QDARGIWAIFEGGTPDDRLDWTPSFICKDDTPYSDGTGNPDSGDDYSAAPDIDHINPRVQ
QELIDWMNWLKIEIGFDGWRFDFARGFSPAFTKFYMAKTRPKFAVGEIWKSLSYRSDGKP
SYNQDSHRRELVEWVRGAGGAVNAFDFTTKGILQAAVEGELWRMKDLNGKPPGMIGLMPG
NAVTFIDNHDTGSTLQHWPFPSDKVMQGYAYILTHPGIPSIFYDHFFEWGLKEEIMKLII
IRSRNRIKPNSAVRILASDSDLYVAAIDGKIIVKIGPRFDVGNLVPKSFKKIATSGKDYC
VWEKK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggatattgctacttctctttcatgtctcctgttcttcatcaccatccttccggcctta
acagcttctccaatattgtttcagggtttcaattgggaatcatccaaaaaggaaggaggg
tggtacaacttcctcatcaactccattcctgaactggctgcttctggaatcactcatgtt
tggcttcctccaccctctcagtctgtttcacctgaagggtacatgccaggaaggctttat
gatctgaatgcatccaaatatggcacccaagatgaactgaaaacactgataaaggtgttt
cacagcaagggggtccagtgcatagcagacatagttataaaccacagaactgcagagaag
caagacgcaagaggaatatgggccatctttgaaggaggaaccccagatgatcgccttgac
tggaccccatctttcatttgcaaggacgacactccttattccgacggcaccggaaaccct
gattctggagatgactacagtgccgcaccagacatcgaccacatcaacccacgggttcag
caagagctaatagactggatgaactggctgaagattgaaatagggtttgatggatggcgg
tttgattttgctagaggattctccccagcttttaccaagttttatatggcaaagaccagg
ccaaaatttgcagtaggggaaatttggaagtctctttcttatagaagtgatggtaagcca
agctacaaccaagatagtcatcggcgtgagcttgtggaatgggtgagaggcgctggagga
gcagtgaatgcatttgattttacaaccaaagggatactccaagctgcagtggaaggggaa
ctgtggagaatgaaggatttgaatggaaagcccccaggaatgattgggttaatgcctgga
aatgctgtgactttcatagataatcatgatacaggttccactctgcaacactggcctttc
ccatcagacaaagtcatgcagggatatgcttatattctcacccatcctgggattccatcc
atattctatgaccatttctttgagtggggtctgaaagaggagattatgaagctgatcata
atcagaagcaggaacaggatcaagcccaacagcgcagtgcggattctggcctctgactcg
gacctctatgtagctgcaatagatgggaagatcattgtcaagattgggccaaggtttgat
gtcgggaaccttgttcctaaatcattcaaaaaaattgccacttctggaaaagattattgt
gtatgggagaaaaaataa

DBGET integrated database retrieval system