KEGG   Vitis vinifera (wine grape): 100250344Help
Entry
100250344         CDS       T01084                                 

Definition
(RefSeq) enoyl-[acyl-carrier-protein] reductase [NADH] 1, chloroplastic
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00061  Fatty acid biosynthesis
vvi00780  Biotin metabolism
vvi01100  Metabolic pathways
vvi01212  Fatty acid metabolism
Module
vvi_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    100250344
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    100250344
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    100250344
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:vvi01004]
    100250344
Enzymes [BR:vvi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     100250344
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     100250344
Lipid biosynthesis proteins [BR:vvi01004]
 Fatty acid synthase
  Component type
   100250344
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-GeneID: 100250344
NCBI-ProteinID: XP_002279058
LinkDB All DBs
Position
8
AA seq 391 aa AA seqDB search
MAATANPSMHMATANPCISSSRKIIKPSTASFVTKVKRAAWSRLTSSSHLSSARLFFQNS
TSTPARFEKVVTKAMADASENKPLPGLPVDLRGKRAFIAGVADDNGYGWAIAKSLAAAGA
EILIGTWVPALNIFESSLRRGKFDESRKLPDGSLMEITKVYPLDAVFDSLDDVPEDVKTN
KRYAGSSNWTVQEVAESVKQDFGSIDILVHSLANGPEVTKPLLETSRKGYLAAISASSYS
FVSLLKHFLPIMNPGGASISLTYIASERIIPGYGGGMSSAKASLESDTRVLAFEAGRKHK
IRVNTISAGPLGSRAAKAIGFIDMMINYSLANAPLQKELHAEEVGNAAAFLVSPLASAIT
GAVVYVDNGLNAMGVGVDSPIFENLDIPKDH
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaactgcaaatcccagcatgcacatggcaactgccaatccatgcatttcttct
tctcgcaaaattatcaagccaagcacagcatcttttgtgaccaaggttaaaagggcagct
tggtccaggcttacaagctcttcgcacttgtcatccgcacggctgttctttcagaactcc
acttcaactcctgcaagatttgaaaaggttgttacaaaggcaatggctgatgcaagtgag
aacaagcctctgccgggattgccagttgatttgagaggtaagagggcatttattgcgggt
gtagctgatgataatggatatggttgggcaatagcaaaatcgcttgctgctgcaggagct
gaaattcttattggcacatgggtgcctgccctcaacatttttgaaagcagtctacgtcgt
gggaaatttgacgaatcacgcaagttgccagatggttctttaatggagatcaccaaagtt
tatcccttggatgcagtttttgacagtcttgatgatgtccctgaagatgtaaaaacaaac
aaacgctatgcagggtcctcaaattggactgttcaggaagttgctgaatctgttaaacag
gattttggaagcatcgacatccttgtgcactcactcgccaatggaccagaggtcaccaaa
ccactcctggagacatcaagaaagggatatcttgcagctatttctgcatcaagttattcc
tttgtttctttgctcaagcatttcctcccaataatgaatccagggggtgcttcaatttct
ctaacatacattgcctcagaacggatcattcctggatatggtgggggcatgagttcagca
aaggcttctctggagagtgatacacgggtactggcttttgaagctgggagaaaacacaaa
atcagagtcaataccatatctgcaggtccattaggaagtcgtgctgcaaaagcaattgga
tttattgacatgatgatcaactactctttggccaatgcgcccttacagaaagaactacat
gcagaggaggtggggaatgctgctgcttttttggtgtcaccattggcttctgctatcact
ggtgctgttgtgtatgtggacaatggtctgaatgcaatgggggtgggagtcgacagccca
atatttgaaaaccttgacattccaaaagatcactag

DBGET integrated database retrieval system