KEGG   Vitis vinifera (wine grape): 100254718Help
Entry
100254718         CDS       T01084                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00020  Citrate cycle (TCA cycle)
vvi00190  Oxidative phosphorylation
vvi01100  Metabolic pathways
vvi01110  Biosynthesis of secondary metabolites
vvi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100254718
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100254718
Enzymes [BR:vvi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100254718
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 100254718
NCBI-ProteinID: XP_002269407
UniProt: D7SPF1
LinkDB All DBs
Position
4
AA seq 670 aa AA seqDB search
MWRCVSRGLRFRSSDSKRSLTSEYLKPHISRFFSTESTGGGSSGTSEAEIKAAIGELSKH
GVDTAGITELYRSSYTSSYTIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPT
RSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENY
GLPFSRTEDGRIYQRAFGGQSLNFGKGGQAYRCACAADRTGHALLHTLYGQAMKHNTQFF
VEYFALDLLMDNDGACQGVIALNMEDGTLHRFQAASTILATGGYGRTYFSATSAHTCTGD
GNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAK
DLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEVLKERLPGISETAAIFAGVDV
TKEPIPVLPTVHYNMGGIPTNYHGEVLTIKGNDPDAVVPGLMAAGEAACASVHGANRLGA
NSLLDIVVFGRACANRVAEIHKPGEKQKPLEKDSGEKTIAWLDKLRNSNGSIPTSKIRLN
MQRVMQNNAAVFRTQETLEEGCKLIDKAWESFHDVQLKDRSLIWNSDLSETIELENLLIN
ACITMHSAEARKESRGAHAREDFTKRDDENWIRHTLGYWENEKVRLDYRPVHMNPLDDEI
ESIPPKARVY
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgcgtttctcgtggccttcgcttccgttcttcggattcgaagcgatccctc
accagcgaatatctgaaacctcacatttccagattcttctctactgaatcgactggggga
ggatcctcaggcactagcgaggcagagattaaagctgccataggagaactatctaaacat
ggggttgatactgctggcattaccgagctttaccgatcctcatacacctcttcatatact
attgtcgatcatacatatgatgcagttgttgtaggagctggtggggcagggcttagagct
gccataggactatctgagcatgggttcaacactgcttgcattacaaagcttttcccaact
cggtcacacacagttgcagctcagggtggtataaatgctgcattaggaaacatgaccgaa
gatgactggagatggcacatgtatgacactgtcaagggaagtgactggttaggtgaccag
gatgctattcagtacatgtgtagggaggcaccaaaagcagtgatagagcttgagaactat
ggtttacccttttctcgaactgaagatgggagaatatatcaacgtgcatttggtggtcaa
agcctgaactttggaaaaggtggacaggcatatcgttgtgcatgtgctgccgatcgaact
gggcatgctttgttgcatactctatatggccaggctatgaaacataatacacaatttttt
gtagagtactttgcattggatcttttaatggataatgatggtgcatgccaaggtgtaatt
gcattaaatatggaggatgggacattacataggttccaagctgcttcaacaattctagcc
acagggggctatggtagaacatacttctctgcaacctcggcccatacatgcactggtgat
ggtaatgccatggttgcacgtgccgggctccctcttcaggatctcgaatttgtgcagttt
cacccaacaggtatatatggtgctgggtgccttattactgaaggatcccgtggtgaaggt
ggtatcctgaggaatagtgaaggtgaacggtttatggaacgatatgcccctacagcgaag
gatcttgcatcaagagatgttgtttcaagatctatgacaatggaaatccgagaaggtcgt
ggtgtaggacctctgaaagaccatatctacctccacttgaaccacttacctccagaagtt
ctgaaggaacggcttcctggtatctctgaaactgctgccatttttgctggagtagatgtt
acaaaggagcccatccctgttttacccactgttcactataacatgggaggaattcccaca
aattaccatggagaggtattaacaattaaaggcaatgatcccgatgcagtagttcctgga
ctaatggctgctggtgaggctgcctgtgcatcagtccatggtgccaatcgccttggtgca
aattctcttcttgacattgttgtttttggtcgggcttgtgcaaatagggttgcagagatc
cataaaccaggggaaaaacaaaaaccgttggaaaaggattctggggaaaagacaattgca
tggctggacaaactaaggaattcaaatggctcaattccgacctcaaaaatccgtttaaat
atgcagcgagtaatgcaaaataatgctgctgtcttccgcacacaagaaacattagaggaa
ggttgtaagttgattgacaaagcatgggagagctttcatgatgtacagttgaaggatagg
agtctgatatggaactctgacttgtcagagaccatagagttggaaaatcttttgataaac
gcatgtatcaccatgcattctgccgaggccaggaaagagagcagaggagcgcatgcccgt
gaagattttacgaaaagagatgatgagaactggataaggcacactttgggatattgggaa
aatgagaaggttcggctagattacaggccagttcacatgaacccattggacgatgagatt
gagtcgatcccacctaaagcacgcgtatattga

DBGET integrated database retrieval system