KEGG   Vitis vinifera (wine grape): 100255753Help
Entry
100255753         CDS       T01084                                 

Gene name
HXK2
Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00010  Glycolysis / Gluconeogenesis
vvi00051  Fructose and mannose metabolism
vvi00052  Galactose metabolism
vvi00500  Starch and sucrose metabolism
vvi00520  Amino sugar and nucleotide sugar metabolism
vvi01100  Metabolic pathways
vvi01110  Biosynthesis of secondary metabolites
vvi01200  Carbon metabolism
Module
vvi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
vvi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100255753 (HXK2)
   00051 Fructose and mannose metabolism
    100255753 (HXK2)
   00052 Galactose metabolism
    100255753 (HXK2)
   00500 Starch and sucrose metabolism
    100255753 (HXK2)
   00520 Amino sugar and nucleotide sugar metabolism
    100255753 (HXK2)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100255753 (HXK2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vvi04131]
    100255753 (HXK2)
Enzymes [BR:vvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100255753 (HXK2)
Membrane trafficking [BR:vvi04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100255753 (HXK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 100255753
NCBI-ProteinID: NP_001267834
UniProt: F6H088
LinkDB All DBs
Position
18
AA seq 485 aa AA seqDB search
MSVSAVGSFWLSPSPGKLPRPRMVVRSSAVSVAPILTHLQKQCATPLPVLRHVADAMAAD
MRAGLAVDGGSDLKMILSYVDTFPTGNEKGLFYALDLGGTNFRVLRVQLGGKDERVIATE
FEQVTIPQELMFGTSEELFDFIACGLANFAKKEGGKFHLPSGRKREIGFTFSFPVKQTSI
DSGILMKWTKGFAVSGTAGRDVVACLNEAMERQGLDMQVSALVNDTVGTLAGARYWDDDV
MVAVILGTGTNACYVERTDVIPKLQGQMSSSGRTIISTEWGAFSNGLPLTEFDRDMDAAS
INPGEQIFEKTISGMYLGEIVRRVLLKMAEAGALFGEYVSEKLSTPFILRTPDICAMQQD
NSDHLDAVGAILYDVAGVKSDLSVRKMVVEVCDTIVKRGGRLAGAGIVGILQKMEEDSKD
LIFGKRTVVAMDGGLYENYPQYRRYLKEAVTELLGLEMSKNVVIEHSKDGSGIGAALLAA
SNSKY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtttccgccgtcggatctttctggctttccccatctcccgggaagttgccacgg
ccgaggatggtcgtccgatctagcgccgtctccgtcgctccaattttgactcatttacag
aagcagtgtgccactcctttgcctgttctccgccacgtggcagacgccatggccgctgat
atgcgggccgggcttgctgtcgacggtggtagtgatctcaagatgattctcagctatgtc
gatactttccccactgggaatgagaaaggcttgttttatgctttggatcttggtggcacg
aacttccgagtgctgagggtgcaattaggggggaaggatgagagagtgattgccactgaa
tttgagcaagtaacaattcctcaagagttaatgtttggtacctcggaggaacttttcgat
tttattgcttgcggactggcgaattttgcaaagaaggagggtggaaaatttcacctgccg
agtggaaggaaaagagagattggctttacattttctttcccagtcaagcaaacatcaatt
gactctggcatcctaatgaagtggacaaagggttttgccgtctctggaacggcaggaaga
gatgtggttgcttgtctaaatgaagcaatggaaaggcagggactagatatgcaggtgtca
gccctggttaatgacactgtaggaacattggccggagcaagatactgggatgatgatgta
atggttgctgtcattttaggaactggaaccaatgcgtgctatgtagaaagaacagatgtt
attcctaaactacagggccagatgtcttcttctggaagaacgattattagtactgagtgg
ggggcattctcaaatggtctacctttaactgagtttgacagagatatggatgctgctagt
atcaatcctggtgagcagatatttgagaagacaatctctggtatgtaccttggtgaaatt
gtaagaagggtgctactcaagatggctgaagcaggtgctttgtttggcgaatatgtctca
gaaaagttatccacacctttcatactcaggaccccagacatatgtgcaatgcagcaggac
aattctgaccatctggatgctgttggagcaatcctgtatgatgtagctggggtaaagtca
gacctgagtgtcagaaagatggtcgtggaggtttgtgacaccatcgtgaagcgaggtggg
cgcttggctggtgcaggcattgtagggattctccaaaagatggaggaagattcaaaagac
ctcatctttgggaagagaaccgtggtggccatggatggaggcctatatgagaactacccc
cagtatagaagatacctcaaagaagccgtgacagagcttctggggttggagatgtcaaag
aatgtagtcatagaacattcaaaagacgggtctgggattggagctgctctcttagctgct
tcaaactccaagtattaa

DBGET integrated database retrieval system