KEGG   Vitis vinifera (wine grape): 100258618Help
Entry
100258618         CDS       T01084                                 

Definition
(RefSeq) transcription elongation factor B polypeptide 1
  KO
K03872  elongin-C
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100258618
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:vvi04121]
    100258618
   03400 DNA repair and recombination proteins [BR:vvi03400]
    100258618
Ubiquitin system [BR:vvi04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Adoptor protein
     100258618
   ECS complex
     100258618
DNA repair and recombination proteins [BR:vvi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     100258618
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Skp1_POZ BTB
Motif
Other DBs
NCBI-GeneID: 100258618
NCBI-ProteinID: XP_002282124
UniProt: F6GUX4
LinkDB All DBs
Position
6
AA seq 98 aa AA seqDB search
MRKEDTVKLISAEGFEFVIDKRAAMVSQTIRNMLTSPGSFAEREHGEVTFPEISTTILEK
ICQYFYWSLQFASGKDTEFPIEPELTLELMMAANYLHT
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaggaagacactgtgaagctgatcagcgcagagggcttcgaattcgtgatcgac
aagagggctgccatggtttctcagaccatccggaacatgctcacttctcccgggagcttt
gcggaaagggaacatggagaagtcactttcccggagataagcaccaccattcttgagaag
atctgccagtatttctactggtctcttcaatttgcgagtgggaaggatactgagtttccg
attgaacctgagcttactctggagctgatgatggctgctaactatcttcatacttga

DBGET integrated database retrieval system