KEGG   Vitis vinifera (wine grape): 100259567Help
Entry
100259567         CDS       T01084                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00052  Galactose metabolism
vvi00500  Starch and sucrose metabolism
vvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100259567
   00500 Starch and sucrose metabolism
    100259567
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100259567
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 100259567
NCBI-ProteinID: XP_010655876
LinkDB All DBs
Position
10
AA seq 882 aa AA seqDB search
NAKNEEDLVGYGYRVRSVSFDPSGNSLTAHLDLIKPSPVFGPDVRNLILVASLETNDRLR
IRITDSEHQRWEIPREILPRYTQLHLRVLPQNHSISPEDDHNSPENNIVCDPKSDLVFTL
RRTTPFGFIVSRRSTGDILFDASSDASEAGTFLVFKDQYLQVSSALPILRSSLYGLGEHT
KKTFKLAQNQTLTLWNTDIHSSNLDVNLYGSHPFYMDVRLTDNRGKVPMGTTHGVLLLNS
NGMDIVYTGDRITYKAIGGVLDFYFFSGPTPEMVVQQYTELIGHPAPMPYWSFGFHQCRY
GYTNVSDVEGVVAGYAKAGIPLEVMWTDIDYMDAYKDFTLDPINFPLDKIKKLVDTLHQN
GQKYVLILDPGISVNQTYRTYKRGMEADIFIKRDGIPYLGSVWPGPVYFPDFVNPATEIF
WGGEIKIFRDSLPIDGLWLDMNEISNFITSPPTPLSTLDDPPYKINNAGVRRPINNRTVP
ATSLHFGNITEYNAHNLYGILESKATNAALTKLTGKRPFILTRSTFVGSGKYAAHWTGDN
AATWDDLAYSIPAVLNFGLFGIPMVGADICGFSGDTNEELCRRWIQLGAFYPFARDHSAK
FTIRQELYVWDSVAATAKKVLGLRYRLLPYFYTLMYEAHTKGVPIARPLFFSFPQDPETY
GINFQFLIGKGVMVSPVLKPGEVSVKAYFPSGNWFDLFNYSNAVSAGSGKYTTLDAPPDH
INVHVREGNILVMQGEAMTTKAARKTPFQLLVVLSSSGISTGEVFLDDGEEVEMGGGGKN
WSLVKFYAWVEDKKAIVGSEVMNRGFALSQKWIIDRVTLIGLTKAQGKRFKGFEVYTNEG
TKTIGDSSLKVDLDGNRKFVVMEIKKLXLPIGKEFELKLNLT
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
aacgcaaagaatgaagaagacctagtgggatatggttacagagtccgatcggtcagcttt
gatccatccggcaactcgttgactgcccatcttgacctcatcaaaccttcccccgttttc
ggccccgacgttcgaaatctcattcttgttgccagcttggaaacgaatgatcgtctccga
attcgaatcaccgattccgagcaccaaagatgggaaatcccccgagaaatccttccccgt
tacacccaactccacctccgagtgctcccgcaaaaccactccatctcgccggaagacgac
cacaactcgccggaaaacaacatagtatgcgaccccaagtcagacctcgtcttcacgctc
cgcagaaccactccattcggctttatcgtcagccgtcgctctaccggcgacatcctcttt
gacgcctcatccgacgcttcagaggctggcaccttcctggtattcaaggaccagtacctc
caggtctcctccgccctccccatcctccgctcctccctttatggcctaggagagcacacc
aagaagactttcaagctcgcccaaaaccaaacgctgacgctttggaacaccgacatccac
agctccaaccttgatgtgaatctgtatgggtcccaccccttctacatggacgtcaggctg
acggacaaccgcggcaaggttccgatggggacgacgcacggtgttctgctgctgaacagt
aatggcatggacatcgtgtacactggtgatcgaataacctacaaagcaattggaggagtt
ctcgatttttacttcttctccggaccgacgccggagatggtggtgcagcagtatacagag
ctcataggccacccggcaccaatgccatattggtcgtttggatttcaccagtgcagatat
gggtacacgaacgtttctgatgttgagggcgtggttgctggttatgccaaagctggtatc
cctctcgaagttatgtggacagatatcgattatatggatgcatataaggattttactctt
gatcccatcaactttcctttggataagatcaagaaattggttgatacacttcaccaaaat
ggtcagaaatatgtgctcattttggatcctggtatcagcgtcaaccagacatatcgaacc
tacaaaagagggatggaagctgatatcttcataaaacgtgatggtatcccctacctgggt
agtgtttggccggggccagtctacttccctgattttgttaatccagccactgagatcttt
tggggtggtgagatcaaaatatttcgagatagtcttcccattgacggcctttggcttgac
atgaatgagatatctaatttcattacctcaccacccaccccattgtccacccttgacgac
cctccctacaagattaacaatgcaggtgttcgtaggcccattaataatagaactgttcca
gccacatctctacactttggtaacattacagagtacaacgctcacaacctttatggaatc
ttagaatccaaagccaccaatgcggccttaaccaaattgacgggtaaaagaccatttata
ctgaccagatcaacttttgtgggctctggaaagtatgctgcccattggactggagacaat
gctgccacatgggatgatttggcttactccatcccagcagttttaaattttgggctattc
ggaattccaatggttggagcggacatatgtggtttttccggcgacacaaatgaagagctc
tgcaggcgatggatccagttaggggcgttctacccctttgcaagggaccactcagcaaag
ttcacaattcgccaggagctttacgtgtgggactcagttgctgcaacagccaagaaggtg
ctggggctccgctaccgcctgcttccctacttttacacgttaatgtacgaagcccacaca
aaaggagtccccattgcccgaccccttttcttttcattccctcaggaccccgaaacttat
ggaatcaactttcagtttttgatcggtaaaggtgtaatggtgtcaccagtgctgaagcct
ggagaagtttcagtcaaagcatacttcccatcaggaaactggttcgacctcttcaattac
tccaatgcagtgagtgcaggttcagggaagtataccactctcgatgcaccaccagatcat
ataaatgttcatgttagagaagggaatatattggtaatgcagggagaagccatgactaca
aaagcggctcggaagactccattccagctcttggtggttttgagcagcagtggaatcagc
actggtgaagttttcttggatgatggcgaagaagttgagatgggcgggggaggaaaaaac
tggagcctggtgaagttctatgcctgggtggaagataagaaggcgattgttggatcagag
gtgatgaatagaggctttgctctaagtcagaaatggatcatagatagggtgactttgatc
gggttgaccaaggcccagggcaagaggtttaaaggattcgaggtatacacaaatgaggga
acaaaaacaattggagactcttcgttgaaagtagatttggatggcaacagaaaatttgtt
gtcatggagattaaaaaactgnntctcccaatcggaaaggagtttgaattaaagctaaac
ctcacttaa

DBGET integrated database retrieval system