KEGG   Vitis vinifera (wine grape): 100261197Help
Entry
100261197         CDS       T01084                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00010  Glycolysis / Gluconeogenesis
vvi00020  Citrate cycle (TCA cycle)
vvi00620  Pyruvate metabolism
vvi01100  Metabolic pathways
vvi01110  Biosynthesis of secondary metabolites
vvi01200  Carbon metabolism
Module
vvi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100261197
   00020 Citrate cycle (TCA cycle)
    100261197
   00620 Pyruvate metabolism
    100261197
Enzymes [BR:vvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     100261197
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 100261197
NCBI-ProteinID: XP_002282287
UniProt: F6HFN8
LinkDB All DBs
Position
1
AA seq 488 aa AA seqDB search
MASPLLSRVSISNATAGNTISFSSSVSNGLLWRRSIAFPDKSSRKVSTVQAKIREIFMPA
LSSTMTEGKIVSWIKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVGDGEVAPV
GAPIGLLAETEEEIAEAKAKASKSGSSAPPPPPAPAAASASPAAPAVAPPKSAASAAVPD
GPKKIVATPFAKKLAKQHKVDIGSVVGTGPFGRITPADVEAAAGISPSKSTGVNVVSSVA
AAPAPAPVAAAAPKAAASPAPPPIPGSTVVPFTTMQAAVSKNMVESLSVPTFRVGYPVLT
DKLDALYEKVKPKGVTMTALLAKAAAMALAQHPVVNASCKDGKTFTYNSSINIAVAVAIN
GGLITPVLQDADKLDLYLLSQKWKELVEKARAKQLQPHEYNSGTFTLSNLGMFGVDRFDA
ILPPGQGAIMAVGASKPTVVTDKDGFFSVKSKMLVNVTADHRIIYGADLAAFLQTFAKIV
ENPESLTL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcttcacctcttctctctagggtttccatctccaacgccaccgctggtaacaccatt
tccttctcatcttcagtctccaatggccttttgtggcggcgatccattgcatttcccgat
aaatctagccggaaggtctctactgttcaagccaagatcagggaaattttcatgcccgct
cttagctccaccatgaccgagggcaagatcgtgtcctggatcaaatccgaaggcgacgtc
ctctccaaaggtgagagcgtcgtcgttgttgagtccgataaggccgacatggatgtcgag
accttctacgatggaattctcgcggcaattgttgttggcgatggagaagttgctccggtc
ggtgctccgatcgggcttttggcggaaaccgaagaggaaatcgcggaagccaaagctaaa
gcttcaaaatctggttcttccgcgcctccgcctcctccagctccggctgccgcttcggct
tcaccggctgctccagctgttgccccgcctaagtcggctgcttcggcggcggtacctgat
ggaccgaagaagattgttgcgacgccttttgcgaagaagcttgcgaagcagcataaggtg
gatattggttcggtggttgggacgggaccattcgggcggataacgccggcggatgtggag
gcagccgccggaatttcaccttccaagagcactggcgtcaatgtggtttcatccgttgct
gctgctcctgctcctgctccggtggctgctgccgcaccaaaagctgctgcttctccggct
cctcctcccattccggggtcgacggttgttcctttcactactatgcaagctgcagtgtca
aaaaatatggtggaaagcctttctgttcccacttttcgcgttgggtatccagtgttaact
gataagctggatgctctatatgagaaggtgaaaccaaagggtgtaaccatgactgctttg
ttagcaaaggcagcagctatggcacttgctcagcacccagttgttaatgcaagttgtaaa
gatgggaagacttttacatataacagcagtataaacattgcggtagcagtggcaatcaat
ggtgggttgataacccctgttcttcaggatgctgataagttggatctctatctgttatct
caaaagtggaaagagcttgtagagaaagctagggcaaaacaacttcagccccatgagtac
aattcagggaccttcactctgtccaatttgggcatgtttggtgtagacaggtttgatgct
attctgcctcctggtcagggggctatcatggccgttggagcttcaaagcctactgttgtc
actgataaagatggattcttcagtgttaaaagtaaaatgctggtaaatgttacagctgat
caccgaattatctatggtgctgacttggcagccttccttcagacctttgcaaagatcgtt
gagaacccagaaagcttgacattgtag

DBGET integrated database retrieval system