KEGG   Vitis vinifera (wine grape): 100266754Help
Entry
100266754         CDS       T01084                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00564  Glycerophospholipid metabolism
vvi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100266754
Enzymes [BR:vvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     100266754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 Pyr_redox GIDA FAD_binding_3 NAD_binding_8 Lycopene_cycl HI0933_like Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 100266754
NCBI-ProteinID: XP_002273219
LinkDB All DBs
Position
13
AA seq 629 aa AA seqDB search
MATTSTRLRRLGTVAAAVALSAGVTLRDPPISSSDRGGPSLDAVRRKIADSNGVVPSRAV
QESALIGSSAVNPLDILVVGGGATGCGVALDAATRGLRVGLVEREDFSSGTSSRSTKLLH
GGVRYLEKAVFNLDYGQLKLVFHALEERKQVIENAPHLCQALPCMTPCFDWFEVVYYWMG
LKLYDLVAGSRLLHLSRYYSAQESVELFPTLARNGKDRSLRGTVVYYDGQMNDSRLNVAL
ACTAALAGAAVLNHAEVVSLLMDEVSNQIIGARIRDNLSGKEFDTYAKVVVNAAGPFCDS
VRKMADKESQPMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTTD
SNTSITMLPEPHEDEIQFILDAISDYLNVKVRRTDVLSAWSGIRPLAVDPKAKSTESISR
DHVVCEDHPGLVTITGGKWTTYRSMAEDAVDAAIKSGKLSPTNECLTNNLHLSGSEDWDP
ASFTVLAQQYVRMKRSHSGKVVPGVMDTAAAKHLSHAYGTMADRVAAIAQDEHLGKRLAH
GYPFLEAEVAYCARNEYCESAVDFIARRSRLAFLDTDAASRALPRIIGILATEHNWDRTR
KKKELQKAKEFLETFKSSRNAQFYDGKHK
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggccaccacctccactcgcctgaggcgactcggaacagtcgctgccgccgtcgcgctc
tccgccggcgtcaccctccgagatcctcctatctcctccagcgaccgaggcggtccctcg
ctcgatgccgtccgccggaaaatcgctgactccaacggtgtcgttccttccagagccgtg
caggagtcggcactgatcggctctagcgctgtcaatcctctcgacatcctcgtcgtaggc
ggaggcgccaccggttgcggcgtggcgctggacgctgccacgagagggcttcgtgtcggg
cttgtggagagggaggacttctcttctggaacttcttcaaggtccaccaagttacttcat
ggaggggtccggtacttggagaaagctgtttttaatcttgactatggacaactaaagctg
gttttccatgcacttgaggagcgcaagcaggttattgagaatgctcctcacctttgtcaa
gctttgccatgcatgacgccatgttttgactggtttgaagttgtatactactggatgggc
ttgaaattatatgatctggtggcaggatcacgcctgctacatttgtccagatattattct
gcacaagagtctgttgaactcttccccactcttgcaagaaatggtaaagatagaagcttg
agaggcacagttgtgtactatgatgggcagatgaatgactcccgacttaatgttgcgttg
gcatgcactgctgcattagctggtgcagctgtgcttaaccatgcagaagtagtatcactt
cttatggatgaggttagcaaccaaataataggtgcacgtattcgagacaatctatcaggc
aaagagtttgacacatatgcaaaagttgttgtgaatgctgctgggccattttgtgactct
gtcaggaaaatggctgacaaagaatcacagccaatgatctgtcctagcagtggtgtacat
attgttctccctgattactattcgcctgagggaatgggtctcattgtccccaaaactaag
gatggacgtgtagtattcatgttaccatggttgggaagaacagttgcaggcactactgat
tccaacactagcatcacaatgcttccagaaccgcatgaggatgagatccaatttatactc
gatgctatcagtgattaccttaatgttaaggtacggcgcacagatgttctctctgcttgg
agtggcattcgtccactggccgtggatccaaaggcgaaaagcactgagagcatttcccga
gatcatgttgtatgtgaagatcatcctgggttagtcacaatcacaggtggaaaatggacc
acttatcggagcatggcagaagatgcagttgatgcagctataaagtctggaaagctgagt
ccgaccaatgaatgcttgacaaataacttacacctttctggaagtgaagattgggatcct
gcttcttttacagtgcttgcccaacaatatgtgcgtatgaagaggagccacagtggtaaa
gttgtcccaggagtaatggacactgctgcagcaaagcatttgtctcatgcatatggtact
atggctgatcgagtggctgctatagctcaggatgaacatctagggaagcggcttgcccat
ggatacccttttctagaggctgaagtggcatactgtgcccgtaatgagtactgtgaatct
gctgtagatttcattgctaggagatcacggcttgcttttcttgacactgatgcagcaagc
agggctctgccacgcataattgggatactagcaacggaacacaattgggaccgcacaagg
aagaagaaagagttgcagaaggctaaagaattcttggagacatttaagtcatctagaaac
gctcagttctatgatgggaaacacaaatag

DBGET integrated database retrieval system