KEGG   Vitis vinifera (wine grape): 100266816Help
Entry
100266816         CDS       T01084                                 

Definition
(RefSeq) DNA ligase 6
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi03030  DNA replication
vvi03410  Base excision repair
vvi03420  Nucleotide excision repair
vvi03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100266816
   03410 Base excision repair
    100266816
   03420 Nucleotide excision repair
    100266816
   03430 Mismatch repair
    100266816
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:vvi03032]
    100266816
   03400 DNA repair and recombination proteins [BR:vvi03400]
    100266816
Enzymes [BR:vvi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100266816
    6.5.1.6  DNA ligase (ATP or NAD+)
     100266816
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     100266816
DNA replication proteins [BR:vvi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    100266816
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     100266816
DNA repair and recombination proteins [BR:vvi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100266816
   NER (nucleotide excision repair)
    Other NER factors
     100266816
   MMR (mismatch excision repair)
    Other MMR factors
     100266816
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C UBA_4 RMMBL
Motif
Other DBs
NCBI-GeneID: 100266816
NCBI-ProteinID: XP_002266168
LinkDB All DBs
Position
14
AA seq 1449 aa AA seqDB search
MVRTVGDALAPSNLPTPNLCKHPPPLQLPETPMAAPQSSSSETMTLDSAHLFLNSHKSLS
QHQSPQPPPPPSLSFLSNHSPLPPIPTNFPQSKLIPKSRFVVDGFRCSGDYSVTYFLSHF
HSDHYSGLSPKWSNGIIFCSNTTARLLVEVLGVSSLFVYPLAVSQPVLIDGCEVALLDAN
HCPGAVQFLFKVPGVDGRFERYVHTGDFRFCESMKLEPCLGEFVGSEAVFLDTTYCNPKF
VFPSQDESVDYIVEAIERIGLENKGLMKSVLFLVATYVIGKERILLEISRRRNCKIHVDG
RKMSVLRVLGYEDGGVFTEDESKSDVHVVGWNVLGETWPYFRPNFVKMKEIMIERGYSKV
VGFVPTGWTYEVKRNKFAMRTKDSFEIHLVPYSEHSNYDELREYVKFLRPKRVIPTVGLD
IEKLDSKHANAMRKHFAGLVDEMAIKHEFLKGFQRGCLEADENVENNTRTVLNKELDAEK
HVTFSKRKTKESTESGFLAVSSSSMQEPGSRDSTLLNDKGSEEVIQELRDCLPIWVTQNQ
MLDLLSCSDGNVIEAVSNFYERETEFREQVIGHTNSVCTSQTSSLKDSVSLSKLGSVGSS
PQKMEDIHGSQSYSLLNIRSSMKSSSLSSGKRKKNLDKKSIKKGKVGSKPESGGSKQSTI
TRFFSKIASNDSQSGDGISEQLSDNENSFPSEAITSYEEQVEQFIKIVNVDESSRYYVSS
ILKKTKGDINMALDIYYSKPEGNLGENEERLVVSSKSIQPECCIQSCSSELEKKVSEKES
GNIVEAKGLSRDTIAATLVSLPLEKYSPIEHACWKLGQPAPYLHLARTFDLVEGEKGKIK
AASMLCNMFRSLLALSPEDVIPAVYLCTNKIAADHENMELNIGGSIVTSAMEEACGTSRS
KIRAMYNSLGDLGDVAQVCRQTQSFLAPPSPLLIKDVFSMLRNISVQTGSGSIVRKKSLI
LNLMRSCREKEIKFLVRTLVRNLRIGAMMRTVLPALAQAVVLHSSPNFYHKGTTENIKEK
LQCLSAAVVEAYNILPNLDLLIPSLLDKGIGFSSSSLSMVPGIPIKPMLAKITNGVPQAL
KLFQNKAFTCEYKYDGQRAQIHKLVDGSVRIFSRNGDETTSRFPDLVSVVRESCKPDALT
FILDAEVVAIDRKNGSKLMSFQELSSRERGSKDSLITLDSIKVDICVFVFDIMFANGKQL
LDIPLRQRRKYLKDLFNNQKLGYFEYAEETTVEADDASTNEATLTKINLFLEEAFRSSCE
GIMIKSLDIDAGYSPSKRTDTWLKVKRDYVEGLNDSLDLVPIGAWHGNGRKAGWYSPFLM
ACYNPDTEEFQSVCRVMSGFSDNFYKEMKEFFNEDKILSKKPPYYQTAELPDMWFTPELI
WEIRGADFTVSPVHQAAIGLVHPSRGISVRFPRFIRPIMDRRPEECSTAADIADMFHFQT
RKMDVTHHN
NT seq 4350 nt NT seq  +upstreamnt  +downstreamnt
atggtacggacagtgggcgatgctttggcgccatccaacctccccactccgaacctctgt
aagcacccaccaccgcttcaactgccagaaaccccaatggcggctccccaatcttcctcc
tccgaaaccatgacgttagattccgctcacctttttctcaactcccacaaatcactctct
caacaccaatctccccaaccccctccacctccctccctctcttttctctccaatcactcc
cctctccccccaatccccaccaattttcctcagtccaagctcattcccaaatcccggttc
gttgtcgatgggtttcggtgctccggcgactactccgtcacctacttcctctctcacttc
cactccgatcactattccgggctcagccctaagtggtccaatggtattatattctgttca
aatacaactgcacgccttctcgttgaagtgcttggggtctcttctttgtttgtttatcct
ttggcggtgtcccaacccgttttgattgatggatgtgaagtggcgcttctcgatgcaaat
cactgccccggagcggtgcaatttttgttcaaggttcctggtgtggatggtaggtttgaa
aggtatgttcatactggtgattttaggttttgtgaatcgatgaaattggagccttgtttg
ggtgaatttgttggttctgaagcggtttttttggatacgacctattgtaatccaaagttt
gtatttccgtctcaagatgaatctgttgattatatagttgaggcgatagagagaattggc
cttgagaacaagggtttgatgaagtctgttttgtttcttgtagctacttatgttattgga
aaagagaggatattgcttgaaatatcaagaaggcgtaactgtaaaatacatgtagatggt
agaaaaatgtcggtgttgcgagttttagggtatgaggatggtggggtatttacagaggat
gagtctaagagtgatgttcatgttgttggatggaatgtattgggtgagacttggccttat
tttagacccaattttgtgaagatgaaggagattatgattgaaagagggtactcaaaagtt
gtgggctttgttcctacagggtggacgtatgaagtaaagcgcaacaagtttgccatgagg
actaaggattcatttgagatccatcttgtaccatacagtgaacattcaaactatgatgag
ctcagagaatatgttaaatttttgagaccaaagcgtgttattcctacagtaggattggac
attgagaaacttgacagtaaacatgctaatgccatgagaaagcattttgctggtttggtt
gatgaaatggccatcaagcatgaattcttgaagggttttcaacgtgggtgcctggaagca
gatgaaaatgttgaaaataatacgagaactgtcctgaacaaggagctggatgcagagaaa
catgtgactttttccaaaaggaaaacgaaagaaagtacagaatcaggatttcttgcagta
tcttcatcttctatgcaagaacctggttcacgagattcaactttgctgaatgataaagga
tcagaggaagtcatacaagaacttcgtgattgcttgcccatctgggtcactcaaaaccag
atgttagatctccttagctgctcagatggaaatgtcattgaagcagtttctaatttctat
gagcgtgaaactgaatttcgtgagcaggtcattgggcatacaaattctgtatgtacatct
cagacaagctcactcaaagattctgtgtcactatctaaactgggttctgtggggagcagc
cctcagaaaatggaggatattcatggtagccaaagctacagtttactcaacattaggagt
tccatgaagagcagcagtctctcttctgggaaaaggaagaaaaaccttgacaaaaagtca
attaagaaaggaaaagttggttcaaaaccagaatctggtggctcaaaacaatctacaata
acaaggttcttcagtaagatagcgagtaatgattctcaaagtggggatggtatatctgaa
caactttctgataatgaaaattcatttccaagtgaggctatcacatcttatgaagaacag
gttgagcagttcattaagatagtaaatgttgatgaatcgtcaagatactatgtttcctcc
atcctgaagaagacgaaaggagatattaatatggctctggacatatactatagtaaacct
gagggtaaccttggtgagaatgaagagaggttggtggtcagtagcaaatcgattcaacct
gaatgctgtatccaaagttgcagttctgagctagagaaaaaagtatcagagaaggaatca
ggaaatatagttgaagctaaggggctatcaagagatactatagctgcaactcttgtatca
ttaccgctggaaaaatattctccaatagagcacgcatgctggaagcttgggcagcctgcc
ccatatttacatcttgctcggacttttgacctggttgagggtgagaagggcaagataaaa
gcagcttctatgctgtgcaatatgtttagaagtttgttggccttgtctcctgaggatgtg
atacctgctgtatatctctgcacaaataagattgctgctgaccatgaaaatatggaacta
aatattggtggaagtatagtcacatctgcaatggaagaggcatgtgggacaagcaggtct
aaaataagggccatgtacaatagcttaggtgatcttggtgatgttgctcaagtatgccga
caaacacagtcattccttgcccctccttcaccgctactaattaaagatgtgttttccatg
ctccgaaatataagtgtacaaacaggcagtggaagtattgttcgaaagaaaagccttatt
ttgaatctcatgcggtcctgtagagagaaggaaataaagtttcttgttagaactttggtt
aggaatttacgaattggggcaatgatgagaactgttctgcctgcattggctcaagctgtt
gtcctgcattcctctcctaacttttatcataaaggaacaacagaaaacataaaggagaag
cttcagtgtctttctgcagcagttgttgaagcatataatatacttcccaatttggatttg
ctcattccttctctcctggacaaaggcattggattttcttcatcaagtttgtctatggtt
ccaggaatacctattaagccaatgcttgcaaaaatcaccaatggagtccctcaagcttta
aagctcttccaaaataaagcttttacatgtgaatataaatatgatggtcagcgcgcccaa
attcacaaactagttgatggatcggtgcgtatcttttcaagaaatggggatgaaacgaca
tcaaggtttccagatttggttagtgtggtcagggaatcatgtaagcctgatgcattgact
ttcatactggatgctgaggtagttgcaattgatagaaagaatggcagcaagctcatgtcc
ttccaggaattatcttcacgagagagaggaagcaaagattccttgatcacattggatagc
ataaaggttgacatttgtgtctttgtctttgatatcatgtttgctaatggaaaacagctt
ttggatattcctctgcgtcaaagaagaaaatatttgaaggatttgtttaacaaccagaaa
ttgggttattttgaatatgcagaggaaacaacagtggaagcagatgatgcttcaaccaat
gaagccacattgactaaaataaatttgtttcttgaagaagcatttcgctcctcatgtgaa
ggaattatgattaaatctctagatattgatgctggatattctccatctaagcgtactgac
acatggttaaaggtcaagcgagattatgtggaaggattgaatgactcacttgatttagtc
ccaatcggtgcttggcatggcaatgggagaaaagcaggctggtatagtccattcctcatg
gcttgttacaaccctgacacagaggaattccaaagtgtatgtcgtgtcatgtcagggttc
tcagataatttctacaaagagatgaaagagttctttaatgaagacaagatattatccaaa
aagccaccttattatcagacagctgagctgcccgatatgtggtttactccagaacttatt
tgggaaataagaggggcagacttcactgtgtctccagttcatcaggcagccataggttta
gttcatccatcccgtggcatctcagtacgatttccaaggttcattcgacctataatggat
agaagaccagaggaatgtagcacagctgcagatatagctgatatgtttcattttcagacc
agaaagatggatgtaacacaccataattga

DBGET integrated database retrieval system