KEGG   Vitis vinifera (wine grape): 100267386Help
Entry
100267386         CDS       T01084                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00010  Glycolysis / Gluconeogenesis
vvi00053  Ascorbate and aldarate metabolism
vvi00071  Fatty acid degradation
vvi00280  Valine, leucine and isoleucine degradation
vvi00310  Lysine degradation
vvi00330  Arginine and proline metabolism
vvi00340  Histidine metabolism
vvi00380  Tryptophan metabolism
vvi00410  beta-Alanine metabolism
vvi00561  Glycerolipid metabolism
vvi00620  Pyruvate metabolism
vvi00903  Limonene and pinene degradation
vvi01100  Metabolic pathways
vvi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100267386
   00053 Ascorbate and aldarate metabolism
    100267386
   00620 Pyruvate metabolism
    100267386
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100267386
   00561 Glycerolipid metabolism
    100267386
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100267386
   00310 Lysine degradation
    100267386
   00330 Arginine and proline metabolism
    100267386
   00340 Histidine metabolism
    100267386
   00380 Tryptophan metabolism
    100267386
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100267386
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    100267386
Enzymes [BR:vvi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100267386
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh AAA_25
Motif
Other DBs
NCBI-GeneID: 100267386
NCBI-ProteinID: XP_010653335
LinkDB All DBs
Position
1
AA seq 538 aa AA seqDB search
MTIPRISSLLSRSFTSSASSALLSSIGRNSSRRGGIFRYSTAAVVEEPINPSVNVNYTQL
LINGQFVDAATGKTFETLDPRTGNVIASVAEGDAEDVNRAVSAARKAFDEGPWPRMSPYE
RSKILLRFADLLEKHNDEIAALETWDNGKPFEQAAKAEVPLVIRLMRYYAGWADKIHGLT
VPADGLHQVQTLHEPIGVAGQIIPWNFPLLMYAWKIGPALACGNTIVLKTAEQTPLSALY
ASKLLHEAGLPPGVLNVVSGYGPTAGAALASHMDVDKLAFTGSTATGKIVLQLAARSNLK
PVTLELGGKSPFIVCEDANVDEAVELAHFALFFNQGQCCCAGSRTFVHESIYDEFVEKAK
ARALRRTVGDPFKAGIEQGPQIDSDQFEKILRYIRSGVENGATLETGGERFGKEGFFIKP
TVFSNVQDGMLIAQDEIFGPVQSILKFKDLGEVIRRANATSYGLAAGVFTQNLDTANTLT
RALKVGTVWINCFDVFDAAIPFGGYKMSGHGREKGIYSLQNYLQVKAVITPLKNPAWL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgactattcctaggatctcatcgctgctctctcgctctttcacttcttctgcttcttct
gctttgctttcttccatagggaggaattcatcccggaggggcgggatctttagatatagc
actgctgcagttgttgaagaaccaatcaatccttctgttaatgtcaattatactcagctt
ttaatcaatggacaatttgtggatgccgcaacggggaaaacttttgagacattggacccc
aggacagggaatgtgattgccagtgttgctgaaggtgacgcagaagatgttaatcgagct
gtctcggctgctcgcaaggcgtttgatgagggaccatggcctaggatgagtccttatgag
agatccaagatactcttgcgttttgctgatttgcttgaaaagcacaatgatgagattgca
gcactcgagacttgggataatgggaaaccatttgaacaggctgcaaaggctgaagtacca
ttggtgatacgtttgatgcggtactatgcgggttgggcagataagattcatggtctcacg
gttcctgctgatggattgcatcaagtgcaaaccttgcatgaacccattggcgttgctgga
cagattatcccctggaatttcccacttctcatgtatgcttggaagattggacctgcatta
gcatgtggtaacactatcgttctaaagacagcagagcagacaccattgtctgctttatat
gcatcgaagttattgcatgaggccgggcttcctccaggtgttctaaatgtggtttctggt
tatggtccaactgctggtgcagcacttgccagccatatggatgtggacaagcttgctttc
actggatcaactgcaactggaaaaattgtacttcaattggctgcaaggagcaatcttaag
ccagtgactttagagcttggagggaaatcccctttcattgtgtgtgaggatgctaatgta
gatgaggctgttgagctagcccactttgctttattctttaatcaggggcaatgttgttgt
gctggctcccgtacatttgtacatgaaagtatatacgatgagtttgtagagaaggcgaaa
gcacgtgctttaagacgcaccgttggtgatccattcaaggcaggcattgagcaaggcccc
cagattgattcagatcaatttgagaagatcctgagatacataagatctggtgtcgaaaat
ggagccacccttgaaaccggaggtgagagatttggcaaagagggcttcttcattaagcct
acagttttctctaatgttcaggacggcatgttgatagcacaggacgagatatttggacca
gtgcagtccatcctgaaattcaaggaccttggtgaggtgataagaagggcaaacgccact
agttatgggctggccgcaggagtctttacccagaacttagacacagccaacaccttgacc
cgcgcactaaaggtgggcacagtatggattaactgctttgatgtgtttgatgcagcgatt
ccttttggtgggtacaagatgagtgggcatggcagagaaaagggtatttacagtcttcaa
aactacctgcaagtgaaggctgttattactcccttgaagaaccccgcgtggttataa

DBGET integrated database retrieval system