KEGG   Vibrio vulnificus 93U204: VV93_v1c00380Help
Entry
VV93_v1c00380     CDS       T03294                                 

Definition
(GenBank) peptide ABC transporter, ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
vvl  Vibrio vulnificus 93U204
Pathway
vvl02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:vvl00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    VV93_v1c00380
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vvl02000]
    VV93_v1c00380
Transporters [BR:vvl02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    VV93_v1c00380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA_29 AAA_22 AAA_16 PRK RsgA_GTPase AAA TniB AAA_30 AAA_23 AAA_18 MMR_HSR1 Mg_chelatase APS_kinase AAA_25 AAA_5 AAA_19 G-alpha DUF87 AAA_27
Motif
Other DBs
NCBI-ProteinID: AIL69140
LinkDB All DBs
Position
I:46854..48569
Genome map
AA seq 571 aa AA seqDB search
MSLLEVKNLRIEYPSRHGIHAAVKSLSFNIERGEIVGVVGESGAGKSTVGNAVSDLLSPP
GRIASGDVFLDGEKISGLSPEAMRKVRGSKIGFIFQDPMTSLNPLFTVEQQLKETIHANM
NVSDEEAYTRALSLMKQVGIPQPENRLKQYPHQFSGGMRQRVVIAIALAGEPDLIIADEP
TTALDVSIQDQILNLIRELCIKHNVGCMLVTHDMGVVSNVTDRVAVMYRGDLVEFGPTVK
VLGNPDHPYTRSLISAVPRSDRKLDRFPLVSYIEEASELQPLDIKNHWLGQSEDQREYTG
PLLNVENVNLRFVTKDSLFESRREYVQASNNVSFQVHEGETFGLVGESGSGKSTIARVIA
GLYAPNSGKVTFEGIDLTALTSEKARRPLRRQMQMVFQNPYTSMNPRMKIFDIIAEPIRF
HKLTNSEAETRQIVNDLLEHVGLGRMAGVKYPHEFSGGQRQRISIARALATRPRLLICDE
PTSALDVSVQAQILNLLKDLQSELNLTMLFISHDLPVIRQMCDRVGVMQMGTLLEVAPTE
QLFRSPQHEYSKHLISLMPEFTGLREEVKTA
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgtcactattagaagtgaaaaatcttcgtatcgagtatccatcgcggcatggtattcat
gcggcggtgaaatcgttgtcgtttaatattgaacgaggcgaaattgttggcgtcgtcggt
gagtcgggtgcgggcaagtcaaccgtaggtaatgcggtgagcgatttgttgagccctcct
ggtcgtattgccagcggtgatgtgttccttgatggcgaaaaaatttcaggcctttctcca
gaagcaatgcgcaaagtgcgtggctctaaaattggttttatcttccaagatccaatgacc
tcgctcaatcctctctttactgttgaacagcagttaaaagaaaccattcacgccaatatg
aatgtctctgacgaagaggcttacacgcgcgcattgtcattaatgaagcaggtgggcatc
cctcaacctgaaaaccgcttaaagcagtatcctcaccagttttctggcggtatgcgtcag
cgcgtggtgattgcgattgccctagcgggcgagccggatttgatcattgccgatgaaccc
accacggcactcgatgtgtcgattcaagaccaaatcctcaacctgatccgcgagttatgt
attaagcataacgtgggttgcatgttggtcacgcacgacatgggcgtggtatcgaacgtg
actgaccgtgttgctgttatgtaccgaggtgacttggttgaatttggcccaacggtcaaa
gtgttgggcaacccagatcatccttatacgcgcagcttgatttcagcggtaccacgttcg
gataggaagcttgatcgcttccctctggtcagctacatcgaagaagcgagcgaattgcag
cctcttgatattaaaaatcactggctgggtcagagtgaagatcagagagaatacaccgga
ccactgctcaatgtggaaaacgttaacttgcgtttcgtcactaaagactcgctgtttgag
agccgtcgtgagtacgtgcaggcatcgaacaatgtcagcttccaagtgcatgaaggggaa
acctttggcttggtgggggaatcgggttcgggtaaatccactatcgcacgagtgatcgcg
gggctgtatgcgcctaactcaggtaaggtgacgtttgaaggtattgatcttactgcgttg
acgtcagaaaaagcgcgccgtcctttacgtcgccaaatgcagatggtcttccaaaatcca
tacacttcgatgaacccgcgcatgaagattttcgatatcatcgcggagcccattcgtttc
cataagttgaccaacagtgaagcggaaacgcgccaaatcgtgaacgatctcttggagcac
gttggcttagggcgaatggctggggtgaaatatccacatgaattttcgggtggccagcgt
cagcgtatttcgattgcgcgcgcattggcgactcgtccacgtcttttaatttgtgatgag
cccacctctgcactggatgtctcggttcaagcacagattctgaatttgctcaaagatcta
caaagcgaactgaacttaaccatgctgtttatcagtcatgaccttccggttatccgccaa
atgtgtgaccgagtcggtgtgatgcagatggggactctgctcgaagtcgcaccgactgag
caactgttccgctctccacagcatgagtacagtaagcacctgatttccttgatgccagag
ttcactggtttgagggaagaggtgaaaacggcataa

DBGET integrated database retrieval system