KEGG   Vibrio vulnificus 93U204: VV93_v1c10980Help
Entry
VV93_v1c10980     CDS       T03294                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vvl  Vibrio vulnificus 93U204
Brite
Enzymes [BR:vvl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VV93_v1c10980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIL70189
UniProt: A0A087JTJ1
LinkDB All DBs
Position
I:complement(1197600..1198184)
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKDALEPHISAETLEFHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTS
TGGIFNNAAQVWNHTFYWHCLAPNAGGEPTGAVAEAINAAFGSFEEFKAKFTDSAINNFG
SSWTWLVKKADGSLAIVNTSNAATPITEEGVTPLLTVDLWEHAYYIDYRNLRPDYMNGFW
ALVNWDFVAENLAK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaactaccagctcttccttacgcaaaagacgcgcttgagccacacatctct
gcagaaactcttgagttccaccacggcaaacaccacaacacttacgttgtgaaactgaac
ggcctaattcctggtactgaattcgaaggtaaaactctagaagagatcatcaagacttct
actggcggtatcttcaacaacgcagcgcaagtatggaaccatactttctactggcactgt
cttgctccaaatgcaggcggcgagccaacaggtgcagttgcagaagcgatcaacgcagca
ttcggttcattcgaagagttcaaagcaaaattcacggattcagcaatcaacaactttggt
tcatcttggacttggttggtgaagaaagcagacggttctctagcaatcgttaacacttca
aatgcggcaacaccaatcactgaagaaggcgtaactccactactgactgtagacctatgg
gaacacgcttactacatcgattaccgcaacctacgtccagactacatgaacggtttctgg
gcactggttaactgggatttcgttgcagagaacctagcgaaataa

DBGET integrated database retrieval system