KEGG   Vibrio vulnificus 93U204: VV93_v1c24300Help
Entry
VV93_v1c24300     CDS       T03294                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
vvl  Vibrio vulnificus 93U204
Pathway
vvl00790  Folate biosynthesis
vvl01100  Metabolic pathways
Module
vvl_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vvl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VV93_v1c24300
Enzymes [BR:vvl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     VV93_v1c24300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AIL71508
LinkDB All DBs
Position
I:complement(2670260..2671090)
Genome map
AA seq 276 aa AA seqDB search
MILRSQKKSLDLSFPVVMGILNVTPDSFSDGGQFNALDAALAQAERMIAAGVSIIDIGGE
STRPGAPEVSLEEELKRVIPAIQAIRQKHDVWISIDTSKAEVMKQAIEAGADLINDVRAL
LEPGALAVAAKAQVPICLMHMQGQPRSMQHNPSYQDVLKEVGEFLEERVAACEEAGIAKE
LLILDPGFGFGKTIEHNYHLLAHLEAFHQLGLPILAGMSRKSMVFKLLNKKPAECMVASV
TCATIAAMKGAQIIRVHDVEETVEAMRVIQMMHKNI
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgattctacgttcccaaaaaaaatccttagatctttcattccctgttgtgatgggaatt
cttaatgtcacacctgactcgttttccgatggaggccaatttaatgcgcttgatgcggca
ttggcccaagccgagcgaatgattgctgcaggtgtgagtatcattgatatcggtggtgag
tcaacacgtccaggtgcgccagaagtctcattggaagaagagttgaagcgcgttattcct
gcaattcaagccattcggcaaaagcacgatgtttggatctctattgataccagcaaagcg
gaagtgatgaagcaagccattgaagccggtgcggatctcatcaatgatgttcgcgcattg
ctggagcctggggccttggcagttgccgcgaaagcccaagttccgatttgtctgatgcac
atgcaaggccaacctcgaagcatgcagcataacccaagctatcaagatgtgttaaaagag
gtcggcgaatttttggaagagcgtgttgcagcctgtgaagaagccggtattgctaaagag
ctgcttattcttgaccccggatttggttttggcaaaaccatcgaacacaattatcatctg
ttagcgcatttagaggcatttcatcaattaggtttgccgattttggcgggcatgtctcgt
aaatcgatggtttttaaattactgaacaaaaagcctgcagagtgcatggtggctagtgta
acatgtgcgacgattgctgctatgaaaggcgctcagatcattcgcgttcatgatgtcgaa
gaaaccgttgaagcgatgcgagtcattcaaatgatgcataaaaatatctga

DBGET integrated database retrieval system