KEGG   Vibrio vulnificus 93U204: VV93_v1c25330
Entry
VV93_v1c25330     CDS       T03294                                 

Definition
(GenBank) diguanylate cyclase
  KO
K20961  diguanylate cyclase [EC:2.7.7.65]
Organism
vvl  Vibrio vulnificus 93U204
Pathway
vvl05111  Biofilm formation - Vibrio cholerae
Brite
KEGG Orthology (KO) [BR:vvl00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   05111 Biofilm formation - Vibrio cholerae
    VV93_v1c25330
Enzymes [BR:vvl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     VV93_v1c25330
SSDB
Motif
Pfam: GGDEF HAMP DUF1449
Other DBs
NCBI-ProteinID: AIL71611
LinkDB
Position
I:complement(2801972..2803243)
AA seq 423 aa
MPQFMNNLPRHSLANRLLRFVSICAIVYLVLLLALMIPFGFKNAKQAHTELEQKLVLSLS
NSAAIALYVNNHEIAEEVIDSLLLHDEINAVRLESLEGVTFDKIKPGQFEKDMWLHANQY
PLLSPVDAKPLGILYVHDNHLVIQRKTLDKVLYQILFVLLQFLMTFVVIALVVKRIIGKP
LRALSIAVSRATPGQVKTVEVDDINRNNEIGLVANSINTFIENSHQALIREKELRSQIER
WEIYYRGMAEQDTLTGLKNRLGCEKHFSHMKHSEAYLSLLLIDLDGFKAVNDSHGHAVGD
AVLSTIANRYLHLTQEHFNQSVVGRIGGDEFVIYLPHRDGPEKMEAFLLAFAEQLIESSN
TPIEVKQLQVHVGCSIGIATATAAKADMEKLLLQADNAMYLAKQDGKNTARFFRRPVSQS
VGN
NT seq 1272 nt   +upstreamnt  +downstreamnt
ttgccacaatttatgaataacttaccgagacattcattagcgaatcgcctgctgagattt
gtttcgatatgcgcgattgtctatctagtgcttttgctggcgctgatgattccgtttggc
tttaaaaatgcgaagcaagcgcatacggagttagaacaaaaattggtgttgtctctctct
aattcggcggccatcgcgttgtatgtcaataaccatgagattgctgaagaggtgattgac
tctttgctgctgcatgatgaaatcaatgctgtgcgtcttgaaagtttagagggcgtgacg
tttgacaaaatcaaaccggggcagtttgaaaaagacatgtggctgcacgcgaatcaatac
cctttactctcaccagtggatgccaaaccgttggggattctgtatgtgcacgacaatcat
ttggtgattcaacgtaaaaccctcgacaaagtgctttaccagattttgtttgttttgctg
cagtttttgatgacgtttgtggtcattgcgttggtggtaaaacgcatcatcggtaagcca
ttgagggcgctctcgattgcggtgtcgcgtgccactccaggacaggtgaaaaccgttgaa
gtggatgatatcaatcgcaacaacgaaatcggtttggtggccaatagcatcaacaccttt
attgaaaactcgcatcaggcactgatccgagagaaagagctacgctctcagattgaacgc
tgggaaatctactaccgtggtatggcggagcaagacaccttaactggtctcaaaaaccgt
ttgggctgtgaaaaacacttttcacacatgaaacacagtgaggcttatttatcactgtta
ctcattgatttagatggttttaaagcagtcaatgacagccatgggcatgcagtgggtgat
gccgtgttatccaccatcgcgaatcgttaccttcatctaacccaagagcattttaatcaa
agtgtcgtggggcggattggtggggatgagtttgtcatttacttgccacatcgtgatggg
ccagaaaaaatggaagcctttttgttggcgtttgctgagcagttaattgagtcgagcaat
acgccgattgaagtgaaacaactgcaagtacatgtcggttgcagtatcggcattgcgacg
gcaacggccgcaaaagccgatatggagaagttgctgcttcaagctgataatgcaatgtac
cttgccaaacaggatggaaaaaacactgcgcgtttttttcgccgaccggttagccagtcg
gtaggtaactga

DBGET integrated database retrieval system