KEGG   Vibrio vulnificus 93U204: VV93_v1c27320Help
Entry
VV93_v1c27320     CDS       T03294                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
vvl  Vibrio vulnificus 93U204
Pathway
vvl00620  Pyruvate metabolism
vvl00680  Methane metabolism
vvl01100  Metabolic pathways
vvl01120  Microbial metabolism in diverse environments
vvl01200  Carbon metabolism
Module
vvl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:vvl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VV93_v1c27320
  09102 Energy metabolism
   00680 Methane metabolism
    VV93_v1c27320
Enzymes [BR:vvl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     VV93_v1c27320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AIL71804
LinkDB All DBs
Position
I:3016000..3018633
Genome map
AA seq 877 aa AA seqDB search
MNEKYAALKSNVSMLGHLLGNTIQEAHGDEILEKVETIRKLSKSARAGNQADRNNLIEEI
KSLPDEQLTPVARAFNQFLNLTNIAEQYHTISRHCDAHVCEPDAINTLFAKLGQNGINKL
DTAQAIRELNIELVLTAHPTEITRRTMINKLVKINECLSKLELSDLSYKERHKTEKRLEQ
LIAQSWHSDVIRKQRPTPLDEAKWGFAVVENSLWEAVPDFLRELDEKLKDYLDQGLPIDA
RPVHFSSWMGGDRDGNPFVSHTVTREVLLLSRWKAADLYLKDINELISELSMTKCNDTVR
QLAGEDEHEPYRAILKQLRTLLSDTKEILDAKINGQKLAVKAPLQSVEQLWDPLFACYQS
LRECGMSMIAEGSLLDTLRRVKAFGVHLVRLDIRQESTRHADVLSELTRYLGIGDYNHWS
EQDKIAFLTNELASKRPLLPRDWQPSEPVKEVLDTCKIIAAQSREAFGAYVISMAKTASD
VLAVHLLLQESGCPYRMDVCPLFETLDDLNNAEAVIKQLMSIDLYRGFIQNHQMVMIGYS
DSAKDAGVMAAGWAQYHAMEALVNVAEQEGIELTLFHGRGGTIGRGGAPAHAALLSQPPK
SLKGGLRVTEQGEMIRFKLGLPDVAVNSFNMYASAILEANLLPPPEPKQEWRDLMEVLSQ
VSCEAYRSVVRGEPDFVPYFRQATPELELGKLPLGSRPAKRNPNGGVESLRAIPWIFSWS
QNRLLLPAWLGAGEAIQYSIDKGHQALLEEMCREWPFFSTRLGMLEMVYLKCNSEISRYY
DERLADKSLLPLGDRLRDQLQSDIKAVLNVENNENLMQSDPWGQESIRLRNIYIEPLNML
QAELLYRTRQAGVVSEALEEALMVTIAGIAAGMRNTG
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaatacgccgcgctcaagagtaatgtcagcatgttggggcacttattgggt
aacaccattcaagaagcccatggcgacgaaatcttagagaaggtggagaccattcgtaag
ctctccaaatctgcccgcgcaggcaatcaggctgatcgtaacaacctgattgaagaaatc
aaaagcctgccagatgagcaactcaccccggtggctcgcgcttttaaccaatttctgaat
ttgaccaacattgccgagcaataccacaccatctctcgccattgcgatgcacacgtgtgt
gagccggatgcgatcaatacgctgtttgctaagcttggtcaaaacggcatcaataaactc
gataccgcccaagcgattcgtgaattgaacattgaactggtgctgactgcgcacccgacg
gaaatcacgcgccgcaccatgatcaataaactggtcaaaatcaacgaatgcctgtctaag
ttagagctgagcgatctttcttacaaagagcgccacaagacagaaaaacgcctcgagcaa
cttatcgcacaaagctggcactcagacgtgattcgcaaacagcgcccaacaccactcgat
gaagcgaagtgggggtttgccgtagtggaaaattcactctgggaagcagtgccagatttt
ctacgcgaactcgatgaaaagctcaaagactatctagaccaaggcttgccaattgatgct
cgccctgttcacttctcatcttggatgggtggtgaccgagatggcaacccgtttgtgagc
catactgtgacacgtgaagtgttgctactctctcgctggaaagcggcggatctttacctc
aaagacatcaatgagttgatcagtgagctgtcaatgaccaagtgcaacgacaccgttcgt
caattggcaggtgaagatgaacacgagccttatcgtgccatcctgaaacaactgcgcacg
ctgctgagtgataccaaagagatcctggatgcgaaaattaacggccagaagctggcagta
aaagcgccgctgcaaagtgttgagcaactttgggatcctcttttcgcttgttatcagtca
ctacgcgaatgtggtatgagcatgatcgccgaaggctcactactcgatacactgcgtcgt
gtcaaagcgtttggtgtgcatctggttcgcttggacattcgccaagaaagtacccgtcac
gctgacgtcctttcagaactgacgcgttacttaggcattggtgattacaatcactggagc
gaacaagacaaaatcgcgttcttgaccaatgaattggcatcgaagcgcccattgctaccg
cgtgattggcaaccttcagagccagtgaaagaagtgctcgatacgtgcaaaatcattgcc
gcgcaatctcgtgaagcgtttggtgcttacgttatctcgatggccaagactgcctctgat
gtactcgcggtgcatctactgctacaagaatcaggctgtccttatcgcatggatgtttgt
ccgctgtttgaaacgctcgacgatctaaacaacgccgaagcggtgatcaaacaattgatg
agcattgacctctatcgtggctttattcaaaaccatcaaatggtgatgatcggttattcc
gactcagcaaaagacgcgggcgtaatggcggcgggttgggctcaataccatgcaatggaa
gccttagtgaacgtcgctgaacaagaaggcattgagctgaccttattccacggccgtggc
ggtaccattggtcgtggcggtgcacccgctcatgcagcgctgctctctcaaccaccaaag
agcttgaaaggcggcctacgcgtcaccgaacaaggtgagatgattcgcttcaaactcggt
ttgcctgatgtggccgttaatagcttcaacatgtacgccagtgcgatccttgaagctaat
ttgctaccaccaccagagccaaaacaagagtggcgcgatctgatggaagtgctgtcgcaa
gtaagctgtgaagcctaccgcagtgtggttcgtggtgagccagactttgtcccttacttc
cgccaagcaacacctgagctggagttgggtaaactgcctctaggctctcgccctgccaag
cgtaacccaaatggtggcgtggaaagcctacgtgcaattccttggattttctcttggagc
caaaaccgcttactattgcctgcgtggttaggtgctggtgaagcgattcagtactcgatt
gacaaaggccatcaagcgcttttagaagaaatgtgccgtgaatggccatttttctccacg
cgtttgggcatgcttgagatggtgtacctcaagtgtaacagtgagatttctcgttattat
gatgaacgtctcgctgacaaatcgctgctaccgcttggtgatcgcttacgtgatcagctg
caaagcgacatcaaagccgtgcttaacgtcgaaaacaacgaaaacttgatgcaaagcgat
ccttggggtcaagagtctattcgactacgtaatatctacatcgaaccgttaaatatgctt
caagcagaattgctttaccgcactcgccaagctggcgtggtatcggaagcgcttgaagaa
gcgttgatggtgaccatcgcgggtatcgccgcaggtatgcgtaacacaggttaa

DBGET integrated database retrieval system