KEGG   Vibrio vulnificus 93U204: VV93_v1c38970Help
Entry
VV93_v1c38970     CDS       T03294                                 

Definition
(GenBank) glycosidase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
vvl  Vibrio vulnificus 93U204
Pathway
vvl00500  Starch and sucrose metabolism
vvl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VV93_v1c38970
Enzymes [BR:vvl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     VV93_v1c38970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: AIL72953
LinkDB All DBs
Position
II:1031534..1032934
Genome map
AA seq 466 aa AA seqDB search
MKPSKFVFLSAAIACSLSSTANADAILHAFNWKYSDVTQNASQIAAAGYKKVLISPALKS
SGNEWWARYQPQDLRVIDSPLGNKSDLKSMIDALKAVGVDVYADVVLNHMANETWKREDL
NYPGSEVLQQYAANTSYYADQTLFGNLTENLFSGFDFHPEGCISDWNDAGNVQYWRLCGG
AGDRGLPDLDPNNWVVSQQRLYLNALKGLGVKGFRIDAVKHMSQYQIDQIFTAEITAGMH
VFGEVITSGGKGDSSYENFLAPYLNATNHSAYDFPLFASIRNAFSYSGGMNMLHDPQAYG
QGLENARSITFTITHDIPTNDGFRYQIMDPKDEELAYAYILGKDGGTPLIYSDNLPDNED
RDNRRWEGVWNRDLMKNMLRFHNQMQGQEMTMLYSDQCLLMFKRGKQGVVGINKCGEERS
HTVDTYQHEFNWYQPYTDTLTGVTETVSSRYHTFRIPARSARMYML
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgtcaaaattcgtttttctctctgctgccatcgcttgcagcctctccagtacc
gccaatgcagacgccattttgcatgcatttaactggaagtactccgacgtcacgcaaaac
gcctcgcaaatcgcggcggcgggttataaaaaagtgctgatttcgccagcactgaaatcg
agtggcaatgaatggtgggcacgttatcaaccgcaagatctgcgcgtgatcgattcccca
cttggcaacaaaagtgacttaaaatccatgattgatgctctgaaggcggtcggcgttgat
gtgtatgccgatgtggtgcttaaccatatggccaatgaaacatggaagcgtgaagactta
aattaccctggcagtgaagtgctgcaacaatacgcagctaacaccagttattatgcggac
caaacgctttttggcaatttaacggaaaacctattctcgggctttgacttccacccagaa
ggctgtattagcgattggaatgatgccggcaatgttcagtactggcgtctttgtggcggt
gctggtgaccgagggctgccagacttagatccgaacaactgggtggtgtcacagcaacgt
ttgtatttgaatgcgctaaaaggtttaggtgtgaaaggcttccgcattgatgcggttaaa
cacatgagccaatatcaaatcgaccagattttcactgcagagattaccgccggaatgcac
gtatttggtgaagtgatcaccagtggtggcaaaggcgactccagctatgagaatttctta
gcgccttatctcaacgccaccaaccattcggcttacgatttcccactgttcgcctctatt
cgcaacgccttctcctacagcggtggcatgaatatgcttcatgatccacaagcctatggt
caagggctagaaaacgcacgttcaattacctttaccatcacgcacgacatcccaacgaac
gacggtttccgttatcaaatcatggatccgaaagatgaagagctggcttacgcttatatc
ctcggtaaagatggcggcacacctctgatttacagcgacaacttacctgataacgaagat
cgtgataatcgccgttgggaaggtgtttggaaccgtgacctgatgaagaacatgttgcgc
ttccataaccaaatgcaagggcaagagatgacgatgctgtacagcgaccagtgtctactg
atgtttaagcgcggtaaacaaggggtggtcggcattaataaatgcggtgaagagcgctct
cataccgttgacacctatcagcatgagttcaactggtatcagccttacacagatacactc
actggcgtgactgaaaccgtgagttcgcgttaccacaccttccgaattccagctcgcagc
gcgcgcatgtacatgctctaa

DBGET integrated database retrieval system