KEGG   Vibrio vulnificus MO6-24/O: VVMO6_00184Help
Entry
VVMO6_00184       CDS       T01415                                 

Definition
(GenBank) biotin carboxylase of acetyl-CoA carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
vvm00061  Fatty acid biosynthesis
vvm00620  Pyruvate metabolism
vvm00640  Propanoate metabolism
vvm01100  Metabolic pathways
vvm01110  Biosynthesis of secondary metabolites
vvm01120  Microbial metabolism in diverse environments
vvm01130  Biosynthesis of antibiotics
vvm01200  Carbon metabolism
vvm01212  Fatty acid metabolism
Module
vvm_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:vvm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VVMO6_00184
   00640 Propanoate metabolism
    VVMO6_00184
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    VVMO6_00184
Enzymes [BR:vvm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     VVMO6_00184
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     VVMO6_00184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADV85206
LinkDB All DBs
Position
I:complement(199946..201292)
Genome map
AA seq 448 aa AA seqDB search
MLDKVVIANRGEIALRILRACKELGIKTVAVHSTADRDLKHVLLADETVCIGPARGIDSY
LNIPRIISAAEVTGAVAIHPGYGFLSENADFAEQVERSGFIFVGPKADTIRMMGDKVSAI
TAMKKAGVPCVPGSDGPLDNDEVKNRAHAKRIGYPVIIKASGGGGGRGMRVVRKEADLVQ
AIAMTRAEAKAAFNNDMVYMEKFLENPRHVEVQVIADGQGGAIHLGERDCSMQRRHQKVV
EEAPAPGITEEMRKYIGERCTRACVEIGYRGAGTFEFLYENGEFYFIEMNTRIQVEHPVT
EMVTGVDLIKEQLRVAAGQPLSFTQNDIKIRGHAIECRINAEDPERFLPSPGKIERFHAP
GGMGVRWESHIYSGYTVPPHYDSMIGKLITYGENRDVAIARMKNALGEMFIEGIKTNIPL
QVSIMNDENFQHGGANIHYLEKKLGLQH
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgctagataaagtagtcatcgcgaaccgaggtgaaatcgcacttcgtatccttcgcgcg
tgtaaagaactcggcatcaaaaccgttgccgtgcactccaccgccgatcgcgatctaaaa
cacgtactgctggcagatgaaactgtgtgtatcggtcctgctcgtggtatcgacagctat
ctgaacattcctcgcattatttcagcagcagaagtgactggcgcggtggcgatccaccca
ggttacggcttcttgtctgaaaacgcagactttgctgaacaagtagaacgtagcgggttc
atctttgtgggtccaaaagcggacaccatccgcatgatgggtgacaaagtatcggctatc
actgcaatgaaaaaagcgggcgttccatgtgtacctggttctgatggtccacttgataac
gacgaagtgaaaaaccgagcacacgcgaaacgtattggttacccagtgatcatcaaagcc
tctggtggcggtggtggtcgtggtatgcgtgtggttcgtaaagaagcagacctcgttcaa
gcaattgccatgacgcgtgcagaagcaaaagcagcattcaacaacgacatggtttacatg
gagaaattcctagaaaacccacgtcacgttgaagttcaagtgattgcagatggccaaggc
ggcgctattcacctaggtgagcgtgactgttcaatgcagcgtcgtcaccaaaaggttgtt
gaagaagcaccagctccaggtattactgaagagatgcgcaagtacatcggtgaacgttgt
actcgtgcttgtgtggaaatcggctaccgcggtgctggtacattcgagttcctctacgaa
aacggtgagttctacttcattgaaatgaacacccgtattcaggttgagcacccagtgact
gaaatggtgactggtgttgacctgatcaaagaacagctgcgcgttgcggcgggccagcct
ctgtcattcacgcagaatgacattaagatccgtggccatgcgattgaatgtcgtatcaac
gcggaagacccagagcgcttcctaccgtctccaggtaagattgaacgcttccacgcacca
ggcggtatgggtgttcgttgggaatcgcacatctacagcggctacaccgtgccaccgcac
tacgactcaatgatcggtaagctgatcacttacggtgaaaaccgtgacgttgcgattgca
cgtatgaagaacgccctgggtgagatgttcattgaaggcatcaagaccaacattccgctg
caagtgagcatcatgaacgatgaaaacttccagcacggtggtgccaacatccactaccta
gagaaaaaactcggccttcagcactaa

DBGET integrated database retrieval system