KEGG   Vibrio vulnificus MO6-24/O: VVMO6_00481
Entry
VVMO6_00481       CDS       T01415                                 

Definition
(GenBank) GGDEF domain protein
  KO
K20961  diguanylate cyclase [EC:2.7.7.65]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
vvm05111  Biofilm formation - Vibrio cholerae
Brite
KEGG Orthology (KO) [BR:vvm00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   05111 Biofilm formation - Vibrio cholerae
    VVMO6_00481
Enzymes [BR:vvm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     VVMO6_00481
SSDB
Motif
Pfam: GGDEF HAMP DUF1449
Other DBs
NCBI-ProteinID: ADV85503
LinkDB
Position
I:534169..535440
AA seq 423 aa
MPQFMNNLPRHSLANRLLRFVSICAIVYLVLLLALMIPFGFKNAQQAHTELEQKLVLSLS
NSAAIALYVNNHEIAEEVIDSLLLHDEINAVRLESLEGVTFDKIKPGQFEKDMWLHANQY
PLLSPVDAKPLGILYVHDNHLVIQRKTLDKVLYQILFVLLQFLMTFVVIALVVKRIIGKP
LRALSIAVSRATPGQVKTVEVDDINRNNEIGLVASSINTFIENSHQALIREKELRSQIER
WEIYYRGMAEQDTLTGLKNRLGCEKHFSHMKHSEAYLSLLLIDLDGFKAVNDSHGHAVGD
AVLSTIANRYLHLTQEHFNQSVVGRIGGDEFVIYLPHRDGPEKMEAFLLAFAEQLIESSN
TPIEVKQLQVHVGCSIGIATATAAKADMEKLLLQADNAMYLAKQDGKNTARFFRRPVSQS
VGN
NT seq 1272 nt   +upstreamnt  +downstreamnt
ttgccacaatttatgaataacttgccgagacattcattagcgaatcgcctgctgagattt
gtttcgatatgcgcgattgtctatctagtgcttttgctggcgctgatgattccgtttggc
tttaaaaatgcgcagcaagcacatacggagttagaacaaaaattggtgttgtctctctct
aactcggcggccatcgcgttgtatgtcaataaccatgagattgccgaagaggtgattgac
tctttgctgctgcatgatgaaatcaatgctgtgcgtcttgaaagtttagagggcgtgacg
tttgacaaaatcaaaccggggcagtttgaaaaagacatgtggctgcacgcgaatcaatac
cctttactctcaccagtggatgccaaaccattggggattctgtatgtgcacgacaatcat
ttggtgattcaacgtaaaaccctcgacaaagtgctttaccagattttgtttgttttgctg
cagtttttgatgacgtttgtggtcattgcgttggtggtaaaacgcatcatcggtaagcca
ttgagggcgctatcgattgcggtgtcgcgtgccactccaggacaggtgaaaaccgttgaa
gtggatgatatcaatcgcaacaacgaaatcggtttggtggccagtagcatcaacaccttt
attgaaaactcgcatcaggcactgatccgagagaaagagctacgctctcagattgaacgt
tgggaaatctactaccgtggtatggcggagcaagacaccttaactggtctcaaaaaccgt
ttgggctgtgaaaaacacttttcacacatgaaacacagtgaggcttatttatcactgtta
ctcattgatttagatggttttaaagcagtcaatgacagccatgggcatgcagtgggtgat
gccgtgttatccaccatcgcgaatcgttaccttcatctgacccaagagcattttaatcaa
agtgtcgttgggcggattggtggggatgagtttgtcatttacttgccacatcgtgatggg
ccagaaaaaatggaagcctttttgttggcgtttgctgagcagttaattgagtcgagcaat
acgccgattgaagtgaaacaactgcaagtacatgtcggttgcagtatcggcattgcgacg
gcaacggccgcaaaagccgatatggagaagttgctgcttcaagctgataatgcaatgtac
cttgccaaacaggatggaaaaaacactgcgcgtttttttcgccgaccggttagccagtcg
gtaggtaactga

DBGET integrated database retrieval system