KEGG   Vibrio vulnificus MO6-24/O: VVMO6_00859Help
Entry
VVMO6_00859       CDS       T01415                                 

Definition
(GenBank) enoyl-CoA hydratase / Delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase / 3-hydroxyacyl-CoA dehydrogenase / 3-hydroxybutyryl-CoA epimerase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
vvm00071  Fatty acid degradation
vvm00280  Valine, leucine and isoleucine degradation
vvm00281  Geraniol degradation
vvm00310  Lysine degradation
vvm00362  Benzoate degradation
vvm00380  Tryptophan metabolism
vvm00410  beta-Alanine metabolism
vvm00640  Propanoate metabolism
vvm00650  Butanoate metabolism
vvm00903  Limonene and pinene degradation
vvm00930  Caprolactam degradation
vvm01100  Metabolic pathways
vvm01110  Biosynthesis of secondary metabolites
vvm01120  Microbial metabolism in diverse environments
vvm01130  Biosynthesis of antibiotics
vvm01200  Carbon metabolism
vvm01212  Fatty acid metabolism
Module
vvm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vvm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    VVMO6_00859
   00650 Butanoate metabolism
    VVMO6_00859
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VVMO6_00859
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VVMO6_00859
   00310 Lysine degradation
    VVMO6_00859
   00380 Tryptophan metabolism
    VVMO6_00859
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VVMO6_00859
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VVMO6_00859
   00281 Geraniol degradation
    VVMO6_00859
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VVMO6_00859
   00930 Caprolactam degradation
    VVMO6_00859
Enzymes [BR:vvm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VVMO6_00859
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VVMO6_00859
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VVMO6_00859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 YcaO
Motif
Other DBs
NCBI-ProteinID: ADV85881
LinkDB All DBs
Position
I:952009..954126
Genome map
AA seq 705 aa AA seqDB search
MSEQKAFNLKIDEQNIAWLGIDVPNEKMNTLQAAFADEMKAIFAQLKDSSGLKGLIVHSL
KPDNFVAGADVRMLEACKTAPEAEALARQGQELFQQLSDLPYPVVAAIHGPCLGGGLELA
LACDFRVCSDDDATRLGLPEVQLGLLPGSGGTQRLPRLIGLLPSLDLILTGKQLRAKKAK
KLGVVDACVPQTILLDVAKQFVEKGKKRAKQKVTTKEKLLSGSGLGRKFVFEQAAKKTHE
KTRGNYPATVAILQVIQHGLEKGMKQGLELEAKRFGELVMSNESKALRSIFFATTEMKKE
TGSEAKPSKVGMVGVLGGGLMGAGISHVSVAKAKVPVRIKDVSNDGVLNALKYNYKLFDK
QRKRRILSKAQLQSKMLQLSGGTDFTSFNRTDVVIEAVFEDLSLKQQMVADIEANAKPET
IFATNTSSLPIHKIAEKAQRPENIVGLHYFSPVEKMPLVEVIPHESTSEETIATVVALAK
KQGKTPIVVKDQAGFYVNRILAPYMNESAHILLANEPIDKIDTALLDFGFPVGPITLLDE
VGVDIGAKIMPILVAELGARFKGPDVFDVLLNDGRKGRKSGKGFYTYKGKKKEVDKSVYK
LLKLTPESKLSDNDIALRCVLPMLNEAVRCLDDGIIRSPRDGDIGAIFGIGFPPFLGGPF
RYMDQFGLKELVEKMNQFAEKYGDRFAPCDGLLTRAGEGRRFYDN
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcaaaaagcgtttaatctaaagattgatgagcagaacattgcatggcttggc
attgatgttccaaacgaaaaaatgaatacccttcaagcggcttttgccgatgaaatgaag
gcgatttttgctcaactgaaagatagcagtggcctaaaagggctgatcgtgcattcgttg
aaacctgacaactttgttgcaggcgcggatgttcgaatgctagaagcgtgcaaaacggcg
ccagaagcagaagcccttgcacgccaaggacaagagttatttcaacaactttctgatttg
ccttatccagtggtggctgcaatccacggcccgtgtctgggtggcggtttggaattggcg
ttagcgtgtgatttccgtgtgtgtagtgacgacgatgccactcgtcttggtttaccagaa
gtccagcttggtctattaccgggctctggtggcactcagcgtctccctcgcttgattggt
cttcttccttcattggatctgatcctgacgggtaaacagcttcgagccaagaaagccaag
aaattgggcgttgtcgatgcctgtgtgccacaaactattttgttggatgtggcaaagcag
tttgttgaaaaaggcaagaagcgcgcaaaacaaaaagtgacgacaaaagagaaattgctc
tctgggagtgggttagggcgtaagtttgtgtttgaacaagcggcgaaaaaaacgcacgaa
aaaacacgtggtaactacccagcgactgtcgccattttgcaagtcatccagcatggcctt
gaaaaaggaatgaagcagggtttggagctggaagcgaagcgctttggtgagttggtcatg
agcaacgagtcgaaggctttacgttcgattttctttgccactacggaaatgaaaaaagaa
acgggcagtgaagcaaaaccaagtaaagtcggaatggtcggcgttcttggtggtggcttg
atgggcgcgggtatcagtcacgtcagtgtggcgaaagccaaagtgccagtacgcattaaa
gacgtcagcaatgacggcgtgctgaacgccttgaaatacaactacaagttgtttgataag
cagcgcaaacgtcgcattctctccaaggcgcaactgcagagcaaaatgctgcaattgagc
ggaggaaccgatttcaccagctttaatcgtaccgacgtggtaattgaagcggtctttgaa
gatctgtcgctcaagcaacaaatggtggcggacattgaagcaaatgcgaagccggagact
atcttcgcgacgaatacctcttctttgccaatccataaaattgccgagaaggcgcagcgg
cctgagaacattgtgggtttgcactactttagtccggtagagaaaatgcccttggtggaa
gtcattccgcatgaatcaacgtcggaagaaaccattgccacggtggtcgctttggcgaag
aaacaaggcaaaacgccgattgtggtgaaagatcaagcgggtttctatgtgaaccgaatt
cttgcgccgtacatgaatgaatctgcgcacattttgctagcaaatgagccgatcgataag
atcgataccgcattattggattttggcttccctgtcggtccaattacgttgctggatgaa
gtgggtgtagatattggtgcgaagatcatgcctatccttgtcgctgagttgggtgctcgc
tttaaagggccagatgtgtttgatgtgcttctcaatgatggccgcaaaggtcgcaagagt
ggaaaaggcttctacacctataaaggcaagaagaaagaagtggataagtccgtttacaaa
ctgctgaaactcaccccagagtcgaagctgagcgacaatgacattgcgcttcgttgtgtg
ctgccaatgctcaacgaagcggtacgctgtttggatgatggcattattcgttctcctcgt
gatggcgacattggggctatcttcggtatcggcttccctcctttcttaggtggcccgttc
cgttatatggaccaatttggtttgaaggaactggtagagaaaatgaaccaattcgctgag
aaatatggcgatcgctttgcgccgtgtgatggcttactcacgcgtgcgggagaaggacgt
cgtttctatgacaactag

DBGET integrated database retrieval system