KEGG   Vibrio vulnificus MO6-24/O: VVMO6_02464Help
Entry
VVMO6_02464       CDS       T01415                                 

Definition
(GenBank) phosphate transport ATP-binding protein PstB
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
vvm02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:vvm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    VVMO6_02464
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vvm02000]
    VVMO6_02464
Enzymes [BR:vvm01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     VVMO6_02464
Transporters [BR:vvm02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    VVMO6_02464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 RsgA_GTPase ABC_ATPase AAA_16 AAA_23 AAA_29 AAA_25 AAA_30 AAA_15 NB-ARC AAA Rad17 AAA_33 AAA_28 AAA_18 NACHT
Motif
Other DBs
NCBI-ProteinID: ADV87486
LinkDB All DBs
Position
I:complement(2644259..2645077)
Genome map
AA seq 272 aa AA seqDB search
MYSFNDTLGYHAPLDVNNLPDDKTAITIENLDLHYGQSQALYDISMRIPKGRVTAFIGPS
GCGKSTLLRCINRMNDLVEGCKVTGSVKLYGSNVYDPSVDVATLRRRVGMVFQRPNPFPK
SIYENVVYGLRLQGVKNSRTLDDAVERSLRSAALWDEVKDRLHENAFGLSGGQQQRLVIA
RAVAIEPEVLLLDEPTSALDPISTLTIEELINDLKTQYTVVIVTHNMQQAARVSDYTAFI
HMGKLIEYSDADTIFTSPMKKQTEDYITGRYG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtattctttcaatgacacattgggctatcacgcccctttagatgtgaataatctgcct
gacgataaaacggccattacgattgagaacttggatctgcactatggtcaaagtcaggca
ctgtacgacatttcgatgcgcattcccaaagggagagtgacggcatttatcggtccgtca
ggttgtggtaagtcaacgttgctgcgttgtatcaatcgcatgaacgatctggtggaagga
tgcaaagtgacaggcagcgttaagctgtatggcagcaatgtttacgatcctagtgtcgac
gttgcaaccttaaggcgtcgggtcgggatggtgtttcaaaggcccaatccatttcctaaa
tccatctatgaaaatgtggtgtatggtttacgcttgcaaggtgtgaaaaatagccgaacg
cttgatgacgcagtagagcgatctttacgctcggcggcgttatgggatgaagtgaaagac
cgcctgcatgagaatgcctttggtctctctggtgggcaacagcagcgattagtcattgcc
cgagcggtcgccatcgagccagaagtgctgttattggacgaacctacatcggctttggat
cctatatcaactttaacgattgaagagcttatcaacgacctaaagactcaatatactgtg
gtcattgtcactcacaacatgcagcaagctgcgcgagtgagcgactatactgcctttatc
cacatgggtaagctcatcgagtattcggacgcagataccatcttcacctctccgatgaaa
aagcaaactgaagattacattactggccgctacggctag

DBGET integrated database retrieval system