KEGG   Vibrio vulnificus MO6-24/O: VVMO6_03748
Entry
VVMO6_03748       CDS       T01415                                 

Definition
(GenBank) oligo-1,6-glucosidase
  KO
K01182  oligo-1,6-glucosidase [EC:3.2.1.10]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
vvm00052  Galactose metabolism
vvm00500  Starch and sucrose metabolism
vvm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    VVMO6_03748
   00500 Starch and sucrose metabolism
    VVMO6_03748
Enzymes [BR:vvm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.10  oligo-1,6-glucosidase
     VVMO6_03748
SSDB
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase Alpha-amylase_C Cyc-maltodext_C
Other DBs
NCBI-ProteinID: ADV88770
LinkDB
Position
II:complement(887211..888845)
AA seq 544 aa
MENKWWHDAVVYQIYPRSFCDSNNDGIGDLNGIISKLDYLKTLGVNVLWLSPVYKSPMDD
NGYDISDYQDIAAEFGTMADMQNLLAQAKARDIRIVMDLVVNHTSDEHPWFVEARKSRDN
PYRDYYIWRDAKPDGSVPDDQGSIFGGSAWQWDEATQQYYFHLFSKRQPDLNWESPKVQQ
EVHKMMNWWIDQGIGGFRLDVIDLIGKEIDKGITGNGPRLHPLLQEMNRATFGDKDLLTV
GETWGATPEIAKLYSDPERHELSMVFQFEHITLTWQHGDKWNPIPLDLKQFKHVLTKWQT
ELSNQGWNSLFWNNHDLPRVVSKYGDDQRYRVESAKMLATALHFLKGTPYIYQGEEIGMT
NVAFESLEQYKDIETLNFYKVKTESGVSHQHMMDAIHENSRDNARTPMQWSASQYGGFSQ
AKPWIEVNPNYPEINVEQALADSDSIFYHYQRLIELRKQHPAIVYGDFTPLFAEHDSVFA
YVRSHQDEQLLVINNFSDQDVSLALPDNLQNKEVNCLIYNYDSLDTLGVTLSLKPYQCYA
FKLR
NT seq 1635 nt   +upstreamnt  +downstreamnt
atggaaaacaaatggtggcacgatgcggtggtctatcaaatctacccgcgtagtttttgc
gactcaaacaacgacggcatcggtgatttaaatggcatcatcagcaaactcgattacctg
aaaacacttggcgtaaacgtgctttggctctcgcccgtgtataagtcgcctatggacgac
aacggctacgacatttctgattatcaagatatcgctgcggaatttggcaccatggccgat
atgcaaaacttacttgctcaagcaaaagcacgtgatatccgcatcgtaatggatcttgtt
gtcaaccatacctcagatgaacacccttggtttgtagaagcgcgtaaatcgagagacaac
ccttatcgtgactactatatttggcgtgatgcgaaaccagatggcagtgtgcccgatgac
caaggctcgatttttggaggcagtgcttggcaatgggatgaagcaacacaacagtattac
ttccatctattttctaagcgacagccggatctcaattgggagagtcctaaagtccagcag
gaagtacacaagatgatgaactggtggattgaccaaggtatcggtggatttaggctcgac
gttatcgacttgattggcaaagagatcgacaaaggcattactggtaatggtccaagactg
catccactactacaggaaatgaacagagcgacgtttggcgacaaagatctgctgaccgtt
ggtgaaacatggggagcaaccccagaaatcgcaaaattgtatagcgatcctgagcgtcat
gaactctctatggtgttccagtttgagcacatcacactcacttggcaacacggtgacaaa
tggaaccctattcctcttgatctcaaacaattcaaacacgtactgaccaagtggcaaacc
gagttatcgaaccaaggttggaactccttgttttggaacaaccatgatttaccacgcgta
gtctcgaaatacggtgatgaccaacgttatcgtgttgagtctgcgaaaatgctggcaacg
gcgttgcatttcctcaaaggcacgccttacatctaccaaggtgaagagatcggtatgacc
aatgtcgcgtttgagtcgttagagcaatacaaagacattgaaacgctgaacttctacaaa
gtgaaaacagaatcaggggtgtcacatcaacatatgatggacgcgatacatgagaacagc
cgtgacaatgctcgcaccccaatgcagtggtccgcatctcagtatggtggctttagtcag
gcgaaaccttggattgaagtgaatccgaactatccagagatcaacgtggaacaagcattg
gcagattcagattccattttctatcactaccaaaggctgattgaactgcgcaaacagcac
ccagcgatcgtctatggcgatttcaccccactgtttgcagagcacgatagtgtgtttgct
tatgtccgctcacatcaagatgagcaactgctggtcatcaacaactttagcgatcaagat
gtttcattagcgttgccggataacttgcaaaacaaagaagttaactgcctgatttataac
tacgattcgttggacacgctcggggtgacattgtcactaaaaccgtatcagtgctacgca
tttaaacttagataa

DBGET integrated database retrieval system