KEGG   Vibrio vulnificus MO6-24/O: VVMO6_03772Help
Entry
VVMO6_03772       CDS       T01415                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
vvm00473  D-Alanine metabolism
vvm00550  Peptidoglycan biosynthesis
vvm01100  Metabolic pathways
vvm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vvm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VVMO6_03772
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VVMO6_03772
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    VVMO6_03772
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vvm01011]
    VVMO6_03772
Enzymes [BR:vvm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     VVMO6_03772
Peptidoglycan biosynthesis and degradation proteins [BR:vvm01011]
 Precursor biosynthesis
  Amino acid ligase
   VVMO6_03772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 TTL
Motif
Other DBs
NCBI-ProteinID: ADV88794
LinkDB All DBs
Position
II:916424..917419
Genome map
AA seq 331 aa AA seqDB search
MMRNVLLLCGGGSSEHEISLLSSEYLQQQLGLIENVNVLKVEIKNEGWFDQKERLVYLDI
HTKSVKSDEFNESIHIDFIVPCIHGFPGETGDIQSLFELASIPYLGCGPEASSNSFNKIT
SKLWYDAIGIPNTPYLFLTENNEESHQLSREAFDKWGKLFVKAARQGSSVGCYSVTNIEQ
LSDAIDKAFGFSHQVLVEKAVKPRELEVSAYEMNGQLHISKPGEIIAPDGAFYSYDEKYS
AGSHSITEVEAKNLTEQQLATIQQCSEKVFRQMNLRHLSRIDFFLTSEGEIYLNEVNTFP
GMTKISMFPKMLQHNGHKFHEFLADCIERSL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgatgagaaatgttctacttttatgcggcggtggttcttcagaacacgaaatttcgctg
ctttcttctgaataccttcagcaacaacttggcttaattgagaatgtaaatgtcctaaag
gttgagattaagaacgaaggttggtttgaccaaaaagagagacttgtgtatctcgatatc
catacgaaaagcgtgaaaagcgatgagtttaatgaatcgatacacatcgatttcattgtg
ccttgtatccatggttttcctggtgaaacaggggatatccagtcactttttgagctagcc
agtattccttatctgggctgtgggcctgaggctagcagtaacagcttcaataaaattacg
tcgaaactatggtatgacgcgattggcattcctaacacaccgtatcttttcctaacagag
aacaatgaagagtctcaccaactcagtagagaggcattcgataaatggggcaaactgttt
gtcaaagcggcgagacaggggtcatcggttggttgttacagtgtaaccaacatagagcag
ctttctgatgccattgataaggcgttcggattctctcatcaggtattggttgaaaaggcc
gtaaaaccaagagaattagaagtttccgcttatgagatgaacggtcaacttcatatttca
aagccaggtgaaattattgctcctgacggtgctttttactcctacgatgagaaatacagc
gcaggtagccattcaatcacagaagtagaagcgaaaaacttaaccgaacagcagttagcg
acgattcagcagtgcagcgagaaagtctttcgtcagatgaaccttcgtcatttgtctcga
atcgatttcttcttaaccagcgaaggtgagatctaccttaatgaagtgaatacctttcct
ggaatgacaaaaatttccatgttccccaaaatgctccaacacaatggacataagtttcat
gaattcctagcggactgcattgaacgctcactttaa

DBGET integrated database retrieval system